KEGG   Flexistipes sinusarabici: Flexsi_1551Help
Entry
Flexsi_1551       CDS       T01539                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
fsi  Flexistipes sinusarabici
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Flexsi_1551
   00030 Pentose phosphate pathway
    Flexsi_1551
   00051 Fructose and mannose metabolism
    Flexsi_1551
   00052 Galactose metabolism
    Flexsi_1551
   00500 Starch and sucrose metabolism
    Flexsi_1551
   00520 Amino sugar and nucleotide sugar metabolism
    Flexsi_1551
  Nucleotide metabolism
   00230 Purine metabolism
    Flexsi_1551
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Flexsi_1551
Enzymes [BR:fsi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Flexsi_1551
    5.4.2.8  phosphomannomutase
     Flexsi_1551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1658278..1659708
Genome map
AA seq 476 aa AA seqDB search
MVDSNIFRQYDIRGVVPDTFNKDVAQQIANAFAFQVKSETGNRVPAIAVGRDVRLSSKDI
FNGVADGIKDAGCDVVELGVCPTPATYFSSFFMEVDAFIMITGSHNPPEYNGIKLGIGHS
TYHSEKITSLYDDITRYGYINADMRGQHRVDTINKHYIDWNIEHFSPLKDKISSLNRNIN
VVIDAGNGVASHVAPEIFEALGVKVTKLYCEPDGNFPNHHPDPTVEDNLEDLKDKIKENG
ADFGVAYDGDADRIGIIDEKQDVIWGDLLLLIYAKELKKKYEKPKIIADVKASKVLFDSL
EKIGAESIMWKTGHSLIKNKLLETGAELAGEMSGHIFFKDDYYGYDDAIYASLRFLQAYV
NNLCEENIGKVSDMLGDIPKVYNTPEIRFDCPDDKKFEIVNKLAEKFKKYLKEGKLGIKE
IIDIDGIRVVFENGWGLLRASNTQPVLVMRFEATDKAEMEQYRKIIEKELKEMMDL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggtggattcaaatattttcagacaatatgatatccgcggggttgttccggatacattt
aataaggatgttgctcaacagattgcaaatgcttttgcgtttcaggttaagagtgaaacg
ggcaacagagtcccggcaattgctgtgggcagagatgtaagattgtcctccaaagatatt
ttcaatggagtggctgacgggataaaagatgccggctgtgatgttgtggaacttggtgta
tgcccgacacctgcaacttatttcagttctttttttatggaagtggatgcttttataatg
attaccggcagtcacaatcctccggaatataatgggataaaactgggtataggtcattcc
acatatcattcagaaaaaataacatccctttatgatgatataacccgttacggttacatt
aatgccgacatgagggggcagcacagagtggataccattaacaaacattatatagactgg
aatatagagcacttttccccccttaaggataaaatctcttcgctgaaccggaacatcaat
gttgtaatcgatgccggtaacggagttgcatcacatgtagctcctgaaatattcgaagct
cttggcgtaaaagtaacaaagctctactgtgagcctgacggaaattttcccaaccaccac
cctgatcccacagtggaagataatctggaagatttaaaagataaaataaaagagaacggg
gctgattttggcgtagcctatgacggagacgcagacagaataggaattatcgatgaaaaa
caggatgtcatatggggtgatcttctcctgctcatctatgcaaaagagttgaagaaaaaa
tatgaaaaacctaaaatcattgcggacgtcaaagcatcgaaagttttgttcgactctctt
gaaaagattggtgcagaaagtattatgtggaagacaggtcattctctgataaaaaacaag
ctcctggaaacaggtgccgaattggccggagaaatgagcggacacatattttttaaagat
gactattacggttatgacgatgccatttacgcatcactgcggtttctgcaggcttatgtc
aacaatctttgcgaggaaaatatcggaaaagtctctgatatgctcggagatattccaaaa
gtctataatacccctgaaatcagattcgactgtcctgatgataaaaagtttgagattgtc
aacaaattagcagaaaaatttaaaaaatatctaaaagaaggtaagctgggaataaaagaa
attatcgatattgacggtataagggtggtttttgaaaacggctgggggcttttaagggca
agtaatacgcagccggtacttgttatgagatttgaagccaccgacaaagctgaaatggag
caataccgcaaaataatcgaaaaagaactgaaagagatgatggatctataa

DBGET integrated database retrieval system