KEGG   Flexistipes sinusarabici: Flexsi_1565Help
Entry
Flexsi_1565       CDS       T01539                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
fsi  Flexistipes sinusarabici
Pathway
fsi00230  Purine metabolism
fsi01100  Metabolic pathways
Module
fsi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Flexsi_1565
Enzymes [BR:fsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Flexsi_1565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 Thymidylate_kin AAA_22 OmpH MMR_HSR1 dCache_2 AAA_35 ABC_tran AAA_17 RsgA_GTPase MobB cobW AAA_16 AAA_30 AAA_19
Motif
Other DBs
NCBI-ProteinID: AEI15215
UniProt: F8E8U2
Position
complement(1677490..1678119)
Genome map
AA seq 209 aa AA seqDB search
MSNQDIAKSPGKLFVVSAPSGAGKTSLCNRLIKKYPDLKYSISHTTRKPRKNEEDGKDYF
FVDENQFNQMIENGDFIEWAVVHENYYGTSADFIKQQLKNGYDVILDIDPQGARILRKKL
GYGVYIFIVASSLKELENRLKKRRSESEEKINKRLQNAIKEVRYYKNYDYLILNDNYNKA
FYELECIFVAEHLKTLEIENIEDIMKLEV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgtctaaccaagatattgctaaaagtccgggtaagctttttgttgtaagtgcaccgagc
ggtgccgggaaaacgagtctgtgcaacagattgattaaaaaataccctgatttgaaatat
tctatatcacataccaccagaaaaccgaggaaaaatgaggaagatggaaaagattacttt
tttgttgatgaaaatcagttcaatcagatgatagagaacggagattttatcgagtgggct
gttgttcatgagaattattacggcacatcggccgattttataaagcagcagctgaaaaac
ggttatgatgttattctggatatcgaccctcagggagcaaggattctgaggaaaaagctg
ggatacggagtatatatttttatagttgcatcaagtcttaaagaattggaaaacaggctt
aagaaaaggcgcagtgaaagtgaggaaaagattaataaaagattgcaaaatgcaattaag
gaagtaagatactataaaaattacgattatttaattctgaatgataattataataaagct
ttttatgagttggaatgtatatttgttgctgaacatttaaagacgttggaaatcgaaaat
atagaagatattatgaaactggaggtttaa

DBGET integrated database retrieval system