KEGG   Flexistipes sinusarabici: Flexsi_1576Help
Entry
Flexsi_1576       CDS       T01539                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
fsi  Flexistipes sinusarabici
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:fsi00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1688463..1689962
Genome map
AA seq 499 aa AA seqDB search
MGKKQYILSIDQGTTSSRAVIFNKTGRIITIAQKEFSQILPKPGWVEQDPLEIWSSVQSV
IAEALANSGLTGGSIQAVGIANQRETTVIWDKNTGKPVYNAIVWQSRQTADICRQLKSKE
LENIFREKTGLVIDPYFSGTKIKWILDNVEGARQKAEKGDLLFGTIDTWLLWKLTKGKVH
ATDYSNASRTLLYNIHQLQWDNKLLNYLNIPSSILPEVKNSSKIFGHTVPETFSGYSVPI
GGIAGDQQAALFGQICFEKGMVKNTYGTGCFILMNTGDKAYHSENGLLTTIAWGINNKID
YALEGSVFVAGAAVQWLRDGLKIIEDAGEIETEAAKVKDSGGVYVVPAFVGLGTPYWDAE
ARGSIFGLTRGTKKEHLARATLESIAYQSKDVISVMQKETGMEIPLLKVDGGAVSNNILM
QFQSDILDTKIQRPLCMETTALGAAFLAGLAVGFWKDTKEIAETWKVDKEFTPKMDTKTA
DNLYGKWLKAVRAAMSYKP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaaagcagtatatcctgtcgatcgatcagggcacgacaagctcaagagctgtt
atatttaacaaaaccggtagaattataactattgcacaaaaagagttctcccaaatattg
ccaaaacccggttgggtggaacaggatcctctggaaatatggtcgtccgtccagtctgta
attgcagaagctttggcaaattctggccttactggtggcagtattcaggcagtcggcatt
gccaatcagcgggaaacaacggttatatgggataaaaacacgggaaaacctgtttataac
gccatagtttggcaatcaagacagactgctgatatatgccggcagctaaaaagcaaagag
ttagaaaacattttccgggaaaaaaccggccttgtaattgatccatatttttctggaaca
aaaataaagtggattctcgacaacgttgaaggagcgcggcaaaaagctgaaaagggagac
ttgcttttcggaacaatcgacacctggctgctctggaaactgacaaaaggcaaagtccat
gcaactgattacagcaacgcttccagaacactcctttacaacatccaccagctacaatgg
gataacaagctgctgaattaccttaatatcccctcatcaatacttcccgaagtcaaaaat
tcctcgaaaattttcggacacaccgttcctgaaacgttttccggttacagcgtcccgatt
ggcggcattgcaggtgaccagcaggcggcattattcggtcagatctgttttgaaaaaggt
atggtgaagaacacatacggaacaggatgttttatactgatgaatacgggggacaaagca
taccattcagaaaatgggttactcacaacaattgcatgggggattaataataaaatagat
tacgctcttgaaggctcggtttttgtagccggagctgcagttcaatggcttagggacggg
ttaaaaattatagaagacgccggagaaattgagacagaggccgctaaagtaaaagattca
ggcggagtatatgtggttcctgcatttgtaggtttgggaacgccgtattgggatgcggag
gcaagagggagtatcttcggattaacgaggggaacaaaaaaagagcaccttgcaagggca
acacttgaatcaatcgcatatcaaagcaaggatgtgatatctgtaatgcagaaggaaaca
ggaatggaaattccgcttctcaaggttgacgggggagctgtttcaaacaatatattaatg
cagttccaaagcgacattctggatactaaaattcagaggcctctttgtatggaaacaact
gcattgggggcagcttttctggcaggactcgcggtgggtttctggaaagatacaaaggaa
attgctgaaacatggaaagtcgacaaagaatttactcccaaaatggatacaaaaacagct
gataatctatacgggaaatggctgaaggctgtgagagcggcaatgagttacaaaccgtaa

DBGET integrated database retrieval system