KEGG   Flexistipes sinusarabici: Flexsi_1643Help
Entry
Flexsi_1643       CDS       T01539                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
fsi  Flexistipes sinusarabici
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Flexsi_1643
Enzymes [BR:fsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Flexsi_1643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1767329..1769179)
Genome map
AA seq 616 aa AA seqDB search
MKKPVNQHNLEPDFNRPLFEVPIDIKRKIINILTLLYGSEVSRRIYPELERIMKVYYAYK
CDDLIEWEKSFDKSEMFGQEDVILITYGDIIQNDSKKPLKVLADFCRDYFSNSFNTIHIL
PFFPYSSDRGFSVKDFEEVDHNLGTWSDIEDIGKDFKLMFDGVFNHISAKSKWFQEFLNG
NPDFKNFFIVLSTSEMVSEDHLKLIVRPRTSSLFTEFQTIEGPKLVWTTFSPDQVDLNFH
NPKVLIKMIDIFLTYVRRGADMIRLDAVTYLWEELGTDCVHLKQTHAIIKLFRVILDAVA
PYVALITETNVPHEQNIQYFGNGYDEAQMVYNFALPPLVYHSFVTGKTNKLTKWAKTIKR
ISEQATYFNFLDSHDGIGLLPVKGILDNDDIDFLVYKTVERGGYISYRTDSDGSESPYEL
NITWYSAINGSDDETGEDQTIRVKRYIASRAIALFFLGVPGIYFHGLIGSKNDAEAVLKE
KNTRSINREVIDGHTLREKLEDKDSISAQIVDNLNELINIRKNEALFQPNARQYVYEISE
KLFAFVRKLDESDEFVLCIINVTRERVLFEIPDELTGKTKLFNELVSKRNINLGKNSKIE
IDGYGIMLIKSSKKPA
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagccggttaatcaacacaatctggaacctgacttcaaccgacccctttttgaa
gtccccatagatatcaagcgtaaaattattaacatccttacccttctgtacggatcggaa
gttagcaggcgtatatatcctgaactggaaaggataatgaaggtatattatgcctataag
tgtgatgatttgatagaatgggaaaagtcttttgataaatccgagatgtttggtcaggaa
gatgttattttgataacatacggagatatcatccagaatgattcaaaaaagccattgaag
gttctggctgatttttgccgcgattatttcagtaattcatttaacacaattcatattctg
cccttttttccatattcgtccgacagaggtttttcggtaaaggatttcgaggaagttgat
cataatctcggaacatggtccgatatagaggatataggcaaagattttaaacttatgttt
gacggcgtttttaaccatatttcagctaagagtaaatggtttcaggagtttttaaacggc
aatccggattttaaaaacttttttattgttttatccacaagcgaaatggtttccgaggac
catctaaaacttattgtcagacctagaacatcttctttgtttacggaatttcagaccatt
gaaggccccaaacttgtttggacaacattcagtccggaccaggttgatttaaattttcac
aatcccaaagttttgattaagatgattgatattttcctgacatatgtcagaagaggcgcc
gatatgataaggctggatgctgtaacctatctctgggaagaactgggtacggattgtgtt
catctcaagcagacacatgctattattaagctttttagagttatactggatgctgttgca
ccttatgttgctttaataactgagaccaatgtacctcatgaacaaaatatccagtatttc
ggcaatggttatgatgaggcacagatggtatataattttgctttgccacccctggtttat
cattcgtttgtgaccggcaaaacaaataaacttacaaaatgggcaaaaacaataaaaagg
atttccgaacaggcgacttactttaatttccttgattcccatgacgggataggattatta
cctgtaaaagggatacttgataatgatgatatagattttttggtatacaagactgttgag
cgtggcggctatatctcctacagaacggattcggacgggagtgaaagcccttacgagctt
aatataacctggtacagtgcaataaacggcagtgatgatgagactggcgaagaccaaaca
atacgtgtaaaaagatatattgcatccagagctatagctctgtttttcttgggagttccg
ggtatttattttcacgggctgattggatccaagaatgatgctgaagctgttctaaaagag
aaaaataccagaagtattaacagggaagtgatagacggacatactttgagagaaaaactt
gaagacaaagattcaatttccgcccaaattgttgataacttaaatgaacttataaacata
agaaagaatgaagctctttttcagccaaatgcccgccaatatgtttatgaaatatcggag
aagttatttgcttttgtaagaaaactggatgaaagtgacgagtttgtattatgcataata
aatgttacacgggagagggtactttttgaaataccggatgagcttaccggtaaaacaaaa
ttatttaatgaacttgtgagtaaaagaaatataaatttgggaaaaaacagtaaaatcgaa
atcgatggttacggcataatgttaataaaatcatcaaaaaaacccgcctaa

DBGET integrated database retrieval system