KEGG   Flexistipes sinusarabici: Flexsi_1672Help
Entry
Flexsi_1672       CDS       T01539                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fsi  Flexistipes sinusarabici
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:fsi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1790209..1790781
Genome map
AA seq 190 aa AA seqDB search
MFYSISGTLVHKEPGKVVLETGGIAYEILIALNTFSALPESGFSVKLYTHLIIREDGMYL
YGFLDEQEKRIFLLLNTVSKVGPKLSLAVLSGISTQKLKDAILSNDYPLIATIPGIGKKT
AERIVLELRDKFDEVFEPVEQRSSAAEDVLSALANLGYKGQDCKNIVTKLSGDYDDFETL
LKESLKKLSK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgttttatagtatttccggcaccttagtacataaagaacccggtaaggttgtattggaa
accggcggcattgcttatgaaattctgattgcactgaacactttttccgctcttcctgaa
tccggattctctgtaaagctttatacccatcttattatcagagaagacggtatgtattta
tacggttttctggatgagcaggagaaacgtatttttttgctgttgaacacagtatccaaa
gtgggtcccaagctttcgctggctgtgttatccgggatatcaacacaaaaacttaaagat
gccattttgagcaatgattatccactcattgccacaattccggggataggcaagaagact
gccgaaagaattgtactggagttaagggataagtttgatgaggtatttgaaccggtggag
cagagatcttctgcagccgaggatgttttgagtgctctggcaaatctcggatacaaggga
caggactgtaaaaatattgtgacaaaactttcaggcgattacgacgattttgaaaccctt
cttaaagaatcactgaaaaaactttccaaataa

DBGET integrated database retrieval system