KEGG   Flexistipes sinusarabici: Flexsi_1672Help
Entry
Flexsi_1672       CDS       T01539                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fsi  Flexistipes sinusarabici
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Flexsi_1672
Enzymes [BR:fsi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Flexsi_1672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1790209..1790781
Genome map
AA seq 190 aa AA seqDB search
MFYSISGTLVHKEPGKVVLETGGIAYEILIALNTFSALPESGFSVKLYTHLIIREDGMYL
YGFLDEQEKRIFLLLNTVSKVGPKLSLAVLSGISTQKLKDAILSNDYPLIATIPGIGKKT
AERIVLELRDKFDEVFEPVEQRSSAAEDVLSALANLGYKGQDCKNIVTKLSGDYDDFETL
LKESLKKLSK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgttttatagtatttccggcaccttagtacataaagaacccggtaaggttgtattggaa
accggcggcattgcttatgaaattctgattgcactgaacactttttccgctcttcctgaa
tccggattctctgtaaagctttatacccatcttattatcagagaagacggtatgtattta
tacggttttctggatgagcaggagaaacgtatttttttgctgttgaacacagtatccaaa
gtgggtcccaagctttcgctggctgtgttatccgggatatcaacacaaaaacttaaagat
gccattttgagcaatgattatccactcattgccacaattccggggataggcaagaagact
gccgaaagaattgtactggagttaagggataagtttgatgaggtatttgaaccggtggag
cagagatcttctgcagccgaggatgttttgagtgctctggcaaatctcggatacaaggga
caggactgtaaaaatattgtgacaaaactttcaggcgattacgacgattttgaaaccctt
cttaaagaatcactgaaaaaactttccaaataa

DBGET integrated database retrieval system