KEGG   Flexistipes sinusarabici: Flexsi_1771Help
Entry
Flexsi_1771       CDS       T01539                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fsi  Flexistipes sinusarabici
Pathway
fsi00010  Glycolysis / Gluconeogenesis
fsi00051  Fructose and mannose metabolism
fsi00562  Inositol phosphate metabolism
fsi01100  Metabolic pathways
fsi01110  Biosynthesis of secondary metabolites
fsi01120  Microbial metabolism in diverse environments
fsi01130  Biosynthesis of antibiotics
fsi01200  Carbon metabolism
fsi01230  Biosynthesis of amino acids
Module
fsi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fsi_M00002  Glycolysis, core module involving three-carbon compounds
fsi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Flexsi_1771
   00051 Fructose and mannose metabolism
    Flexsi_1771
   00562 Inositol phosphate metabolism
    Flexsi_1771
Enzymes [BR:fsi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Flexsi_1771
Exosome [BR:fsi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Flexsi_1771
  Exosomal proteins of bladder cancer cells
   Flexsi_1771
  Exosomal proteins of melanoma cells
   Flexsi_1771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Macro SecA_SW Senescence
Motif
Other DBs
NCBI-ProteinID: AEI15411
UniProt: F8EA00
Position
1891083..1891847
Genome map
AA seq 254 aa AA seqDB search
MRKPFIAGNWKMNLTLDMAQELTDKIAAENIDFNRVGVALIPSYTNLYPVYKILKSTGTE
IRLGSQNVHFEKNGAYTGEVSVEMLKSVGCTFALLGHSERRNILGETDELINKKLHSCID
QGLDAIVCVGETLNEREAHIHKEQTVSQVGKALKGIEKKFLNNIIIAYEPVWAIGTGKTA
GKEDAEEIHSAVRDFIKSKYGEEAASEIKIIYGGSVKPENIKELINMENIDGALVGGASL
KFESFSKIIQNCTI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccttttattgctggcaactggaaaatgaatctaacccttgatatggcacaa
gagctgaccgataaaattgcagccgaaaatatcgactttaacagagttggtgttgcctta
atcccttcttatacgaatctttatcctgtttataaaatactgaaatctacagggacagag
atcaggttgggatctcaaaatgttcatttcgagaaaaacggggcatacaccggtgaagtt
tctgttgaaatgctaaaatctgttgggtgtacgttcgcacttctcggtcattctgaaaga
agaaacatacttggagaaactgacgaattgataaacaaaaagcttcattcctgcattgac
caaggtttggatgccatagtgtgcgttggtgaaacgcttaatgaaagagaagctcatatt
cataaagagcagacagtttcacaggttgggaaagccctgaaagggatagagaaaaagttt
ctaaacaatattatcatagcttatgagccggtctgggctataggaacaggaaaaacagcc
ggaaaagaggatgccgaggaaattcactctgctgtcagagattttattaaatccaaatac
ggcgaagaagctgcatctgaaataaaaattatttatggcggcagtgtcaaaccggaaaat
ataaaagagcttataaatatggaaaatatagacggagctcttgtgggcggagcaagtttg
aagtttgaatcttttagtaaaataatacaaaattgtacgatatag

DBGET integrated database retrieval system