KEGG   Flexistipes sinusarabici: Flexsi_1771Help
Entry
Flexsi_1771       CDS       T01539                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fsi  Flexistipes sinusarabici
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Flexsi_1771
   01230 Biosynthesis of amino acids
    Flexsi_1771
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Flexsi_1771
   00051 Fructose and mannose metabolism
    Flexsi_1771
   00562 Inositol phosphate metabolism
    Flexsi_1771
Enzymes [BR:fsi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Flexsi_1771
Exosome [BR:fsi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Flexsi_1771
  Exosomal proteins of bladder cancer cells
   Flexsi_1771
  Exosomal proteins of melanoma cells
   Flexsi_1771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1891083..1891847
Genome map
AA seq 254 aa AA seqDB search
MRKPFIAGNWKMNLTLDMAQELTDKIAAENIDFNRVGVALIPSYTNLYPVYKILKSTGTE
IRLGSQNVHFEKNGAYTGEVSVEMLKSVGCTFALLGHSERRNILGETDELINKKLHSCID
QGLDAIVCVGETLNEREAHIHKEQTVSQVGKALKGIEKKFLNNIIIAYEPVWAIGTGKTA
GKEDAEEIHSAVRDFIKSKYGEEAASEIKIIYGGSVKPENIKELINMENIDGALVGGASL
KFESFSKIIQNCTI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccttttattgctggcaactggaaaatgaatctaacccttgatatggcacaa
gagctgaccgataaaattgcagccgaaaatatcgactttaacagagttggtgttgcctta
atcccttcttatacgaatctttatcctgtttataaaatactgaaatctacagggacagag
atcaggttgggatctcaaaatgttcatttcgagaaaaacggggcatacaccggtgaagtt
tctgttgaaatgctaaaatctgttgggtgtacgttcgcacttctcggtcattctgaaaga
agaaacatacttggagaaactgacgaattgataaacaaaaagcttcattcctgcattgac
caaggtttggatgccatagtgtgcgttggtgaaacgcttaatgaaagagaagctcatatt
cataaagagcagacagtttcacaggttgggaaagccctgaaagggatagagaaaaagttt
ctaaacaatattatcatagcttatgagccggtctgggctataggaacaggaaaaacagcc
ggaaaagaggatgccgaggaaattcactctgctgtcagagattttattaaatccaaatac
ggcgaagaagctgcatctgaaataaaaattatttatggcggcagtgtcaaaccggaaaat
ataaaagagcttataaatatggaaaatatagacggagctcttgtgggcggagcaagtttg
aagtttgaatcttttagtaaaataatacaaaattgtacgatatag

DBGET integrated database retrieval system