KEGG   Flexistipes sinusarabici: Flexsi_1817Help
Entry
Flexsi_1817       CDS       T01539                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
fsi  Flexistipes sinusarabici
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Flexsi_1817
Enzymes [BR:fsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Flexsi_1817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1942678..1943523)
Genome map
AA seq 281 aa AA seqDB search
MLIRAYAKVNLFLKILNKRQDGFHNIESLMSPVNLFDLLKVQKSRQFRITCNDKTIPVDE
NNIISKTFALVQKKYNLKHLVDVCLYKNIPSGAGLGGGSSNAAAFLQILNEIFSLKMSFD
EKVDIMSKVGSDTVFFLYNQPAFVRGRGEIVDKTAVLPSFYVLLVKPPVTISTSSVYSDK
NLTLTPYNTVSNMHPVLNYTDVLDSVDNGLQNVVFKKYPETYLIKEKMLTLNADAALLSG
SGATVFGIYSSKKYLNKAYDYFKIFNKSYFVYKTENINNVI
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgctgataagagcttatgctaaagtcaatctgtttttgaaaattctgaacaaaagacag
gacggttttcacaatattgaatcgttgatgagccctgttaatcttttcgacctgcttaaa
gtccaaaaaagcaggcagtttcggataacctgtaatgataaaactattccggttgatgaa
aacaatataatttcaaagacgttcgctctggtacaaaaaaaatataatctcaaacatctg
gttgatgtctgtttatacaaaaacattccttcaggagcaggtctgggtggggggagcagc
aatgcagctgctttcttgcaaatacttaatgagattttcagccttaaaatgagttttgat
gaaaaggttgacattatgtcaaaggtgggttcggataccgtttttttcctgtacaatcag
ccggcttttgtcagaggcagaggcgaaatagtggataaaacagcagtgcttccatccttt
tacgtcttgctggtgaaaccccctgtaactatttccacatccagtgtttattcggataaa
aatttaacgttgacaccttataataccgtcagtaatatgcatcccgttttaaattacaca
gatgttctggactccgttgataacggtttgcaaaatgttgtgtttaaaaaatatcctgag
acgtatttgataaaagaaaagatgctgactcttaatgctgacgctgcgctgctttccgga
agcggtgctactgtgtttggaatttactcgtcaaagaaatatttgaataaagcgtatgat
tattttaaaatatttaataaaagctattttgtttataaaactgagaatataaataacgta
atttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system