KEGG   Flexistipes sinusarabici: Flexsi_1892Help
Entry
Flexsi_1892       CDS       T01539                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
fsi  Flexistipes sinusarabici
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Flexsi_1892
   00052 Galactose metabolism
    Flexsi_1892
   00500 Starch and sucrose metabolism
    Flexsi_1892
   00520 Amino sugar and nucleotide sugar metabolism
    Flexsi_1892
Enzymes [BR:fsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Flexsi_1892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2014886..2015770)
Genome map
AA seq 294 aa AA seqDB search
MGVRKAVLPVAGFGTRMLPATKSVAKEMITLIDKPLIHYAVLEAVESGIEQIIFVTSAGK
SEIENYFDKSPNLELALENSGKKELLEEVRNISSMCEFVSVRQKEQKGLGHAVYCARDVV
GDEPFAVILPDDIMRYKTPVTKQLIDNFEETHAPVVALCKVEKKDAHKYGIIEIDKKVKD
NFYKLKTMVEKPKTNPPSDMAIIGRYILTKEILDEIGNTKSGALGEIQLTDAINAVASKN
SVYGYEYEGRRFDCGNKSGYLEAVVNFALEREDISEDFKQILEAAGFKVNDGRL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgggagttagaaaagcagtgctgcctgttgcgggatttgggaccagaatgcttcctgct
accaaatctgtggcaaaagagatgattacacttattgacaagccgttaattcattatgct
gttttagaggctgtggaatcaggaattgagcagataatttttgttacaagtgcaggcaaa
agcgaaatagaaaattattttgataaatctccgaatcttgagctggctttggaaaactca
ggcaaaaaagagctgcttgaagaggtcaggaatattagcagtatgtgcgaatttgtatcg
gtaaggcagaaggaacagaaagggctggggcacgccgtttactgtgcccgggatgttgtt
ggtgatgagccttttgccgtgatcttgcccgatgatattatgagatacaaaacgcctgtt
acaaagcagcttatagataattttgaagaaacccatgctcctgttgttgcactttgcaaa
gtggaaaagaaagatgcccataaatacgggattatcgaaatagacaaaaaagtaaaagat
aatttttataaactgaagacaatggttgaaaaacctaaaacaaatccgccttcggatatg
gctattatcggaagatatatacttaccaaagagattctggatgaaattggcaatacgaaa
tccggagccctgggagaaatccagctgacggacgccataaatgctgtggcgtcaaaaaat
tctgtatacggttacgaatatgagggcagaaggtttgactgcggtaataaatccggttat
ctggaggctgttgtaaactttgctctggaaagggaagatatttccgaagattttaaacaa
atacttgaagcagccggttttaaggtgaatgatggaagactttga

DBGET integrated database retrieval system