KEGG   Flexistipes sinusarabici: Flexsi_1985Help
Entry
Flexsi_1985       CDS       T01539                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
fsi  Flexistipes sinusarabici
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Flexsi_1985
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Flexsi_1985
  Lipid metabolism
   00071 Fatty acid degradation
    Flexsi_1985
  Amino acid metabolism
   00350 Tyrosine metabolism
    Flexsi_1985
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Flexsi_1985
   00626 Naphthalene degradation
    Flexsi_1985
Enzymes [BR:fsi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Flexsi_1985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2116222..2117250)
Genome map
AA seq 342 aa AA seqDB search
MKAMVLKRIVELNQESEPLVLKDYPVPEPINGEILIKVKACGVCHTELDEIEGRTRPPKL
PVIPGHEIVGEVVGMSGGVTKFKKGDRVGVGWIYSACGACFFCNNGLENLCSDFKATGRD
ADGGYAEYMKVNEHYAVKIPDAYEDSQAAPLLCAGAVGYRSLKLARMVNGQNLGFMGFGA
SAHLVLQLAKYLYPDSRFFVFARSASQRDFAKKLGAFWAGDIEDSPPEQCLSIIDTTPVY
KTVLAGLLNIVPSGRVVVNAISKEEFDKESLMNLDYKNHLWMEKELKSVANVTPDDLQDF
INIAAKAGIFPTVEEYPLEKANKALIEIKNGSSIGAKVLTLA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctatggttctaaaaagaattgtagagttaaaccaggaatccgaacctttggta
ttaaaagactatccggtccctgaaccgataaacggggaaatattaataaaggtaaaagcc
tgcggagtttgtcatacagagcttgatgagattgaagggcgtaccagaccccctaagctg
cctgttattcccggccatgaaatagtgggtgaggttgtgggaatgtcaggcggtgtcaca
aaattcaaaaaaggtgacagagtcggagtcggctggatttattcagcttgtggtgcttgt
tttttctgcaataacggactggaaaacctatgcagcgattttaaggccaccggcagggat
gcagacggcggatatgccgaatatatgaaagtcaatgagcattatgctgtaaaaatacct
gatgcgtatgaagattcacaggcggcacctttgctttgtgccggagccgtgggttaccgc
tcgctaaagcttgcccggatggtaaacggacagaaccttggttttatgggattcggtgca
tccgcccatctggttcttcagcttgccaaatacctgtatccggattcccgtttttttgtt
tttgcaaggagtgcatctcagcgggattttgcaaaaaaactcggtgctttttgggcaggg
gatatagaagattcacctccggaacagtgtctgagtattattgacactactccggtgtac
aaaactgtactggcgggtcttttaaatattgtaccttcggggcgtgtagtggttaatgcc
attagtaaagaggaatttgacaaagagtctttgatgaaccttgattacaaaaatcacctt
tggatggaaaaagagttaaaaagtgtggcaaacgttacccctgatgatcttcaggatttt
atcaatattgctgcaaaagcggggatttttcccactgttgaagaatatcctttggaaaaa
gccaacaaagcacttattgagataaaaaatgggagcagtataggagcaaaagttctcacg
ttggcataa

DBGET integrated database retrieval system