KEGG   Flexistipes sinusarabici: Flexsi_2015Help
Entry
Flexsi_2015       CDS       T01539                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
fsi  Flexistipes sinusarabici
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:fsi00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2156570..2158024)
Genome map
AA seq 484 aa AA seqDB search
MSTRVRFAPSPTGHLHVGNARTALFNYLYAASKKGKFILRIEDTDLQRSSMENEEMIYED
MKWLGFYWDEGPRKGGEYGPYRQTERFDLYKKYADKLLENGYAYKCFCSKEELEKEKEKA
LAEGRPPRYSGKCRNLSEGEIEKLENRGIKPSIRFRVNKENVLVSDEIRGDIDFKTDSFG
DFIIVRPDGTPVYNFVVVIDDALMNISHVIRGDDHLSNTPKQVLMFEAMGFDIPKFAHIP
MILGPDHSKLSKRHGVTSINAFRDQGYLPEALFNYLALLSWSDENEREILSREELAEVFS
LERVSKSAAVFDFEKLKWMNGIYIRNLDEDDFFERVKPFIVKSGTTDIHYIDENSERVKQ
MALSVRDNLDLLSDIGDYLKIYFEYPETFDEEASEILSWETTPVVINMLKEEVEKAEEID
GVKYKEIVKKIQKEKKIKGKPLFMAIRVGLSGKTKGPEVDKLATLLDKDEVLKRLAKVSA
HFSE
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaagagttagatttgctcccagtcctaccggacatctgcatgtgggaaatgcc
agaaccgccctttttaattatctttatgcagcctcaaaaaagggaaaatttatcctcaga
atagaggacaccgatttgcagcgctcctcaatggaaaatgaagaaatgatatacgaagat
atgaaatggctgggattttactgggatgaaggaccccgaaaaggcggtgaatatggcccg
tacagacagacggagcggtttgatctgtataaaaagtatgcggataaactgcttgagaat
ggttacgcatataaatgcttctgttcaaaggaggagcttgaaaaggagaaggagaaagct
ttggccgagggcagaccgcccagatacagcgggaaatgcaggaatttatccgaaggtgaa
attgagaaacttgagaatagagggataaaaccttcaatccggtttagagtaaataaagag
aatgtgcttgtgagtgatgaaatcagaggggatattgactttaaaaccgattcgttcggc
gattttatcatagtcaggcctgacggcacaccggtttataattttgtagttgtgatcgat
gatgcgcttatgaatatctcccatgtaatccggggagatgatcacctgagtaatacgccg
aagcaggttcttatgtttgaggctatggggtttgatatacccaaatttgcccatataccg
atgatattggggccggaccattccaaactgagcaaaaggcacggtgttaccagtattaac
gcgttcagggatcagggatatctgcctgaagctttgtttaattaccttgcacttttaagc
tggtcagatgaaaacgaaagggaaattttatcacgtgaggagctcgccgaagtcttcagc
cttgaaagggtttccaaaagtgctgctgtctttgattttgagaagctgaaatggatgaac
ggtatatatatcagaaatcttgacgaagatgatttctttgagagggtaaaaccgtttatt
gttaaatcgggaacgaccgacatacattatattgatgaaaattctgagagggtgaaacag
atggctctttccgtaagggacaaccttgacctgctatctgatatcggagattatcttaag
atttattttgagtatcctgagacttttgatgaggaagcttcggaaattttatcatgggaa
acaacacctgttgtgattaatatgcttaaggaagaagttgaaaaagcagaagaaattgac
ggagtaaaatataaagagattgtgaaaaagatacagaaagagaagaaaatcaaagggaaa
ccgcttttcatggcaattcgggttggtctcagcggtaaaacaaaaggccctgaagtggat
aagcttgccacactcctggacaaagatgaggttttgaaacgtctggcaaaggtttccgct
cattttagtgagtga

DBGET integrated database retrieval system