KEGG   Flexistipes sinusarabici: Flexsi_2020Help
Entry
Flexsi_2020       CDS       T01539                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
fsi  Flexistipes sinusarabici
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Flexsi_2020
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Flexsi_2020
Enzymes [BR:fsi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Flexsi_2020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2162647..2163393
Genome map
AA seq 248 aa AA seqDB search
MLDKILANKKYEIEEIPEILPKRTKDIIEPLQTLKNKPFIAEVKKASPSAGEIKPDASPA
EQAALYEKYGAGAVSVLTDKYFFKGSFEYLKEISEKINTPVLCKDFIISERQIEAAYAFG
ADIILIIAAVLTQEEIGRLSEKARELNLYILYEIHTAEEYEKIKDFSPALVGVNSRNLDT
LEIDKQKGAQILNTLPDSLFKIAESGINSPEDVANFRRAGADAFLIGTYLMKSDNIKESF
QNLYRGLE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcttgataaaatactggcgaacaaaaaatacgagattgaagaaattccggaaattctg
ccaaaaagaacaaaagatattattgagcctttacaaacactaaaaaacaaaccgtttatt
gccgaggttaaaaaggcctcaccctcagccggagaaataaaacccgatgcatcacccgca
gaacaggcggcactatacgagaaatacggggcaggagctgtgagtgtacttaccgacaag
tactttttcaaaggctcattcgaatatctgaaagaaatatccgaaaaaattaataccccg
gtgctttgcaaagattttatcatttctgaaagacagatagaggccgcatatgcttttggt
gcagatattatactaataattgcggccgttttaacacaggaagaaattggcagattatcc
gaaaaagcccgcgagttgaacctttacattctgtatgaaattcacactgctgaagaatac
gaaaagataaaagacttttcacctgctttggtgggtgtaaattcgaggaatctggataca
cttgaaattgacaagcaaaaaggtgcacaaattttaaacacactgccggacagtcttttt
aaaatcgctgaaagcggtataaacagccccgaagatgtagcaaatttccgcagggccggc
gcagatgcttttcttataggtacttaccttatgaaatcagacaatataaaagaaagtttt
caaaatttatacagaggactggaataa

DBGET integrated database retrieval system