KEGG   Flexistipes sinusarabici: Flexsi_2020Help
Entry
Flexsi_2020       CDS       T01539                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
fsi  Flexistipes sinusarabici
Pathway
fsi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fsi01100  Metabolic pathways
fsi01110  Biosynthesis of secondary metabolites
fsi01130  Biosynthesis of antibiotics
fsi01230  Biosynthesis of amino acids
Module
fsi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Flexsi_2020
Enzymes [BR:fsi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Flexsi_2020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE His_biosynth FMN_dh QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEI15649
UniProt: F8E513
Position
2162647..2163393
Genome map
AA seq 248 aa AA seqDB search
MLDKILANKKYEIEEIPEILPKRTKDIIEPLQTLKNKPFIAEVKKASPSAGEIKPDASPA
EQAALYEKYGAGAVSVLTDKYFFKGSFEYLKEISEKINTPVLCKDFIISERQIEAAYAFG
ADIILIIAAVLTQEEIGRLSEKARELNLYILYEIHTAEEYEKIKDFSPALVGVNSRNLDT
LEIDKQKGAQILNTLPDSLFKIAESGINSPEDVANFRRAGADAFLIGTYLMKSDNIKESF
QNLYRGLE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcttgataaaatactggcgaacaaaaaatacgagattgaagaaattccggaaattctg
ccaaaaagaacaaaagatattattgagcctttacaaacactaaaaaacaaaccgtttatt
gccgaggttaaaaaggcctcaccctcagccggagaaataaaacccgatgcatcacccgca
gaacaggcggcactatacgagaaatacggggcaggagctgtgagtgtacttaccgacaag
tactttttcaaaggctcattcgaatatctgaaagaaatatccgaaaaaattaataccccg
gtgctttgcaaagattttatcatttctgaaagacagatagaggccgcatatgcttttggt
gcagatattatactaataattgcggccgttttaacacaggaagaaattggcagattatcc
gaaaaagcccgcgagttgaacctttacattctgtatgaaattcacactgctgaagaatac
gaaaagataaaagacttttcacctgctttggtgggtgtaaattcgaggaatctggataca
cttgaaattgacaagcaaaaaggtgcacaaattttaaacacactgccggacagtcttttt
aaaatcgctgaaagcggtataaacagccccgaagatgtagcaaatttccgcagggccggc
gcagatgcttttcttataggtacttaccttatgaaatcagacaatataaaagaaagtttt
caaaatttatacagaggactggaataa

DBGET integrated database retrieval system