KEGG   Flexistipes sinusarabici: Flexsi_2022Help
Entry
Flexsi_2022       CDS       T01539                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fsi  Flexistipes sinusarabici
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Flexsi_2022
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Flexsi_2022
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Flexsi_2022
Enzymes [BR:fsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Flexsi_2022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2163977..2165146
Genome map
AA seq 389 aa AA seqDB search
MNNGFYGEYGGQFVAETLMPALNELERNFFKAKNDANFNNKFLKYMNDYAGRPTPVYYAE
NLSEKYGFNLYLKREDLLHTGAHKINNTIGQALLALQMGKKRIIAETGAGQHGVATATAC
ALFNLECEIYMGKTDAERQRVNVEKMEMLGAKVTVVDKGSKTLKDAVSACLKDWVANVDD
THYLLGSALGPHPFPSVVSHFQSVIGREAREYFESSDKLPDYVIACVGGGSNAIGIFRGF
MDTEVELIGVEAGGLSDKPGEHAIRFGKGQKGIFQGSHSYVILQKNGQIAPVHSVSAGLD
YPGVGPEHAFLKDSKRVKYEFCRDEDAIFAFYELTRNEGIIPALESSHALGYIFKNSNFF
KEKNILLNLSGRGDKDLEIVREYRGGSLS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacggattttacggggaatacggggggcagtttgtggcggaaacgctcatgccg
gccttgaacgaactggaaagaaatttctttaaagcaaaaaatgatgcaaattttaacaat
aaatttcttaaatatatgaatgattacgcaggcaggccgacaccggtctattatgctgaa
aatctttcagagaaatacggttttaatctttacctgaaaagggaagatctgcttcatacc
ggagcacacaaaattaacaatacaattgggcaggctttgcttgccctgcagatgggtaaa
aagcggatcatagcagaaaccggtgcagggcagcacggcgtggcaacggccacagcatgt
gcacttttcaatctggaatgcgaaatatatatgggaaaaacggatgcagagagacaaaga
gttaacgttgaaaaaatggaaatgctgggcgcaaaagtcactgttgtggataaggggagc
aaaacacttaaagacgctgtcagtgcctgtttaaaggactgggtggcaaatgtagacgat
acccattatctgctcggttcagctttaggtccgcacccttttccgtctgtagtatcccac
tttcaatccgttatcggccgggaagcgagggaatactttgagtcatcagacaaactgccc
gattatgtcattgcatgtgtaggcggtggcagcaacgccatcggtattttcagaggattt
atggatacggaagttgagcttatcggtgtggaagcgggaggattaagtgataaacccgga
gaacacgccataagattcggcaaaggccaaaagggaatctttcagggttcgcattcatat
gtaattctgcagaaaaacggacagattgcccctgttcattccgtttcagcaggtcttgat
tatccaggggtaggacctgagcatgcatttttaaaagacagcaaaagagtaaaatacgaa
ttctgcagggatgaagatgcaatttttgcattttatgaactcacccggaatgaaggaatc
ataccggcactcgaatcaagccacgctttgggatatatattcaaaaacagtaattttttc
aaagagaagaatattctgctgaacctttccggcagaggggacaaggatttggaaattgtc
agggaatacagaggaggaagcctgtcatga

DBGET integrated database retrieval system