KEGG   Flexistipes sinusarabici: Flexsi_2023Help
Entry
Flexsi_2023       CDS       T01539                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fsi  Flexistipes sinusarabici
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Flexsi_2023
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Flexsi_2023
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Flexsi_2023
Enzymes [BR:fsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Flexsi_2023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2165143..2165865
Genome map
AA seq 240 aa AA seqDB search
MKGIYMMIGYPDIETFKEEFIFSQNCGLDFVEIGIPFNDPVADGPVISEAGENVLTKQIN
IEELMDFIRENKKTKIYIMTYSNIIYHYGAENFSKKYKSTIDGVIIADLPNEYHCFFKEE
GFEIPIIPFATTDTDAGKLTQYLDGQNFIYFVGLKGVTGSKADLNNQVNIKKIKEVKEKS
GYKVVFGFGIKTPADASAVMKFADGFVVGTEVVKRQPEPEEFKKYVKSLTESGEIYIRNG
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaatctacatgatgatcggatatccggacatcgaaacatttaaagaggaattc
attttttcccagaactgcgggcttgattttgtggaaatcggtatcccctttaacgacccg
gtggctgacggtccggttatttccgaagccggagaaaatgttctgacaaaacagataaac
attgaagaattaatggattttatccgtgaaaacaaaaaaaccaaaatatatataatgact
tattccaatataatttatcattatggagccgaaaatttcagtaaaaaatataaaagtaca
attgatggagtgattatagctgatttgcctaatgaatatcactgctttttcaaggaagaa
gggttcgagattccgatcattccctttgctacaacagataccgacgccggtaaactcaca
caatatcttgatggtcagaattttatctattttgtcggactgaaaggcgttacgggctca
aaagcggacttaaacaatcaggtaaatatcaaaaaaataaaagaagtaaaagaaaaatcg
ggttacaaggtggtttttggtttcggaatcaaaacaccggctgatgcatcggctgttatg
aaatttgccgacggtttcgtggtgggaacagaggttgtaaaaaggcagccggagccggaa
gaattcaaaaaatatgttaaatcgctgacagaaagcggggaaatatatatacgtaatggg
taa

DBGET integrated database retrieval system