KEGG   Flexistipes sinusarabici: Flexsi_2224Help
Entry
Flexsi_2224       CDS       T01539                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fsi  Flexistipes sinusarabici
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Flexsi_2224
Enzymes [BR:fsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Flexsi_2224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2387397..2389208
Genome map
AA seq 603 aa AA seqDB search
MGTLDELLEKNLINEADYYFARHLFTDKIKNSKSELPLLAALISSLNREGHICVDFESLH
LLEKAPDIFRTKDIKNIVEKNSEYIGAPGEFKPFIFDGKRIYLHKYFEYENFIISNLSER
SRIHYGIGERCAEAFAKDKNDSDVQLNLQNLAVFMGLRNNLSFISGGPGTGKTTTVARLL
YYHLLQNKNINIALAAPTGKAAARMGDSLSDSMKRFNLENTTFTDIQTMTIHRLLGYSPY
LGGFRYSKSGRKKHHPALLGYDLIVVDEASMIDLSLMFHLLKALPLETKLVFLGDRRQLA
SVAPGAVFGDICDIENINAFSEQFAGEYRLFSGEGIKETTVKSPMGDNIVELRKSYRYKS
DSDIAKAAGMIEKGESSRLKDFLVNHSGTGEGSVRLISHSNLSEFFRENLLQHYIDISKS
DDIDKAYKKVFNYQILTPLKRGRFSTESINNYFINALKTYFHLPKLRSYFNGMPVLINKN
DYTNRLFNGDLGLIFGEKSAELKICFPSQEDSSFRQFRLKDIYGYEFAYCLTVHKSQGSE
FDNVVLVLPEKSDFLSRELIYTAVTRARHSVVIIGNPDILAEAVSVKTTRMSGLREKIHG
VTP
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
gtgggaacccttgatgagcttttagagaaaaaccttattaatgaagctgactattatttt
gccagacatctttttaccgacaagattaaaaattctaaaagtgaactcccccttctcgct
gcgcttatttcttctctaaacagagaggggcatatctgtgtagattttgagagtctgcac
cttttggaaaaagcaccggatattttcagaaccaaagacattaaaaatatcgttgaaaaa
aatagcgaatatatcggcgcccccggagaattcaagcctttcatttttgacggcaaaagg
atttatctccacaaatattttgagtatgaaaattttattatttccaatctgtctgaaagg
agcaggatacattacgggataggtgagcgctgcgctgaggcatttgcaaaagataaaaac
gattccgatgtacaactgaatctgcagaatctggcagtgtttatgggacttagaaacaat
ctgtcctttatttcaggtggtccgggaacgggtaaaaccactactgttgccagacttctc
tattatcacttattacagaataaaaatatcaatattgcacttgcggcgcccaccggcaaa
gccgcggccagaatgggggactccctatccgactcaatgaaacgtttcaatctggaaaat
accacctttaccgatatacagacaatgacaattcacagacttctgggatacagcccctat
cttggcggattcagatacagcaaatccggcaggaagaaacatcatccggctttactcggg
tatgatctcattgtggtggatgaagcgtcgatgatagatctgagtttgatgtttcatctt
ttaaaggctttgcctttggagacgaaacttgtttttctaggtgacagaagacagcttgcc
tctgttgctccgggagctgtttttggtgatatatgcgatatcgagaatataaacgccttt
tctgagcagtttgccggggaatacagattattttcaggcgaaggtatcaaagagacgacg
gttaagagtcctatgggtgataatattgtggagcttagaaaaagttacaggtataaaagt
gacagcgatattgctaaagccgccggaatgattgaaaaaggtgaaagcagccggttgaaa
gattttttggtaaaccacagcggcacaggagaagggagcgtaaggctgattagtcacagt
aatcttagtgaattttttagggaaaatctccttcagcactacattgatataagcaaaagt
gatgacatcgataaggcatataaaaaggtgtttaactatcaaattctgacccctcttaaa
agggggcgtttttccaccgaatcaataaacaactattttataaatgctttgaaaacgtat
tttcatttacctaagcttagatcatatttcaacggaatgcctgttctgataaataaaaac
gattatacgaacagactgtttaacggagatctggggttgatcttcggcgaaaaatcagca
gaactgaaaatctgctttccttcacaggaggatagcagcttcaggcaattccgtcttaag
gatatttatggatatgagttcgcctactgtctaacagtccacaaatcccagggttcggaa
tttgataatgttgtgctggttctgccggaaaaaagtgattttctgagccgggagcttatc
tatacggctgtcaccagagcccggcattctgtggtcattatcggtaatcctgacatattg
gccgaagctgtatcggtaaaaacaaccaggatgtccggtttaagggaaaaaattcacggt
gtgactccatga

DBGET integrated database retrieval system