KEGG   Flexistipes sinusarabici: Flexsi_2311Help
Entry
Flexsi_2311       CDS       T01539                                 

Definition
butyrate--CoA ligase (EC:6.2.1.2)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fsi  Flexistipes sinusarabici
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Flexsi_2311
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Flexsi_2311
   00620 Pyruvate metabolism
    Flexsi_2311
   00640 Propanoate metabolism
    Flexsi_2311
  Energy metabolism
   00680 Methane metabolism
    Flexsi_2311
Enzymes [BR:fsi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Flexsi_2311
Lipid biosynthesis proteins [BR:fsi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Flexsi_2311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2483468..2485102)
Genome map
AA seq 544 aa AA seqDB search
MHNMKNYEKTIKEFNIDVPHFFNFGFDVVDKNAETKDNTALIWIDTDGETHEKYTFGDLK
RMSNRFANVLKEQGFKKGDNLYVMVPRVPEWYSVMLGCFKLGVIPMPAPKILREKDIDYR
LKASKARGAVVYGDSIEKFGNLSTPDNFTKIAIKYESKGWQNYEDLMAKAGEYLSREDVE
PTKSTDPLIIYFTSGTTKFPKMVLHDQTYALGHYITARFWQDLTEDDIHWTLSDTGWGKA
VWGKLFGQWLIGTTVVMHNQSDRFDPELHLNILQNFGVTTFCAPPTAYRMLILQDLSKYD
FSKLRHSVSAGEPLNPEVIRKWKEHTKTLIYDGYGQTETVNTVANYPCLEVKPGSMGKPA
PGFTVDIVDDEANPMPFNEAGHIAIKAEGKNQVGIFRGYYRDEEATNAAFHNGWYFTGDK
AYKDEDGYFWFVGRSDDVIKSSGYRVGPFEVESALQTHNAVAESAVIGAPDKLRGTIVKA
FIVLKPGFEGSDELITDIQEHVKNETAPYKYPREIEFVDNLPKTVSGKIRRVELRQMEEN
RRRH
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacatgaaaaattatgaaaaaacaatcaaagaatttaacatcgatgtgcctcat
ttcttcaatttcggttttgatgttgtggacaaaaatgccgaaacaaaggataacactgca
ttaatctggatcgatacggacggtgaaacccatgaaaaatatacatttggcgatttaaaa
agaatgtccaacagatttgcaaatgtattaaaagaacagggctttaaaaaaggtgacaat
ctgtatgttatggttcccagagtgcccgagtggtactcagtcatgcttggctgctttaag
ctcggggttatacctatgccggctccaaaaattttaagggaaaaggatattgactaccga
cttaaagcttcaaaagcacgcggagcagttgtctacggtgattcaatagaaaaattcggg
aatctgtcaacacctgacaattttactaaaatagccataaaatacgaaagcaaagggtgg
cagaattatgaggatcttatggcaaaagccggggaatatctgtcgcgggaagatgtggaa
cccaccaaatccacagatcctctgataatctattttacaagcggtaccacaaagtttccc
aaaatggtacttcacgatcagacatatgccctcggccattacattactgcaaggttctgg
caggatcttactgaagatgatatacactggactctgagtgatacagggtggggaaaagct
gtatggggcaagctgttcggacagtggctgatcggaacaacggtagtaatgcacaatcag
tccgacagatttgacccggaactgcatctgaacatactgcaaaatttcggagtaaccaca
ttctgtgcaccccccacagcatacagaatgcttattctgcaggatttatcaaaatacgat
ttttcaaaactcagacactccgtcagtgcaggagagccgctgaatcctgaagttatcaga
aaatggaaggagcatacaaaaacccttatttacgacggatacgggcagacggaaactgtc
aatactgtagccaattatccgtgcctggaagtaaaacccggctcaatgggcaagccggcc
ccaggatttactgtagatatagttgatgacgaagcaaatcccatgccgtttaacgaagcg
ggacatattgcaataaaagcggaaggaaaaaatcaggttggtattttcagagggtattac
agagatgaagaggccacaaatgcagcattccataacggatggtactttacaggcgacaag
gcttataaggatgaagacggttatttctggtttgtgggaagatccgatgatgtgataaaa
tcaagcggatacagagtgggcccttttgaagtggaaagtgctttgcagacacataacgca
gttgcagaaagtgccgttataggagcgcctgacaaactgaggggaacaattgtaaaagct
tttattgtactaaagcctggctttgaaggcagtgatgagctcatcacggacatacaggag
catgtaaaaaatgagacagcaccatataaatacccccgggaaattgaatttgtagataat
ctgccgaaaacggtaagcggaaaaatcagaagggttgagctcaggcagatggaggaaaac
cgcagaagacattaa

DBGET integrated database retrieval system