KEGG   Fibrobacter succinogenes: Fisuc_0020Help
Entry
Fisuc_0020        CDS       T01099                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
fsu  Fibrobacter succinogenes
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fsu00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:fsu00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(24442..24933)
Genome map
AA seq 163 aa AA seqDB search
MLISAIVAVSENNVIGRDGHLPWHLSADLKRFKAITTGHAIILGRKNYDDIGRPLPNRTN
YVLTRNKDFQAPGCIVCSSLGEAIEAARAAGETECFIIGGAAVYREAMPLVEKLYLTRVL
SHVEGDVFFPEWNDKFQKESAESFPADEKNDFPTTFEIWVRKK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgttaatttctgcaattgttgctgtttctgaaaacaatgtcatcgggcgtgacggtcac
ttgccgtggcacctttctgctgacctcaagcgcttcaaggcgattactacggggcatgct
atcatcctcggtcgcaagaactacgacgatatcggccgcccgcttccgaaccgcacgaac
tacgtgctcacccgcaacaaggatttccaggccccgggctgcattgtctgctcttcgctc
ggtgaggctatcgaggccgcccgcgctgctggtgagacggaatgtttcattatcggtggt
gctgccgtgtaccgcgaagcgatgccgctggttgaaaagctctatttgacgagagttttg
tcgcacgtggaaggcgatgtattcttcccggagtggaacgataagttccagaaagagagc
gcagaatccttcccggcagacgaaaaaaacgacttcccgacaacctttgaaatttgggta
cgaaaaaaataa

DBGET integrated database retrieval system