KEGG   Fibrobacter succinogenes: Fisuc_0020Help
Entry
Fisuc_0020        CDS       T01099                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
fsu  Fibrobacter succinogenes
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Fisuc_0020
   00670 One carbon pool by folate
    Fisuc_0020
Enzymes [BR:fsu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Fisuc_0020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(24442..24933)
Genome map
AA seq 163 aa AA seqDB search
MLISAIVAVSENNVIGRDGHLPWHLSADLKRFKAITTGHAIILGRKNYDDIGRPLPNRTN
YVLTRNKDFQAPGCIVCSSLGEAIEAARAAGETECFIIGGAAVYREAMPLVEKLYLTRVL
SHVEGDVFFPEWNDKFQKESAESFPADEKNDFPTTFEIWVRKK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgttaatttctgcaattgttgctgtttctgaaaacaatgtcatcgggcgtgacggtcac
ttgccgtggcacctttctgctgacctcaagcgcttcaaggcgattactacggggcatgct
atcatcctcggtcgcaagaactacgacgatatcggccgcccgcttccgaaccgcacgaac
tacgtgctcacccgcaacaaggatttccaggccccgggctgcattgtctgctcttcgctc
ggtgaggctatcgaggccgcccgcgctgctggtgagacggaatgtttcattatcggtggt
gctgccgtgtaccgcgaagcgatgccgctggttgaaaagctctatttgacgagagttttg
tcgcacgtggaaggcgatgtattcttcccggagtggaacgataagttccagaaagagagc
gcagaatccttcccggcagacgaaaaaaacgacttcccgacaacctttgaaatttgggta
cgaaaaaaataa

DBGET integrated database retrieval system