KEGG   Fibrobacter succinogenes: Fisuc_0179Help
Entry
Fisuc_0179        CDS       T01099                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fsu  Fibrobacter succinogenes
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fisuc_0179
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fisuc_0179
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Fisuc_0179
Enzymes [BR:fsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Fisuc_0179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
206011..207288
Genome map
AA seq 425 aa AA seqDB search
MTSTTSNNGFFDKFGGKYVAEIIRRPLDDLEAAFNKYIHDPEFLEELRIIQRDYIGRETP
LYFAPTATKLLGGAQIYIKLEGLANTGAHKINNAIGQCLLAKKMGKTRIIAETGAGQHGL
ATAAACAKLGLECVVYMGEVDVRRQQPNVATMEMYGAKVVPVTSGSRTLKDAVNEAMRDW
ATNFQNTHYVLGSALGPAPFPDIVRTFQSIIGEEVKRQAAERNIDIAAVVACVGGGSNSI
GVFTPFIEDKNVRLIGAEAGGVGPNVGENAARMTGNASREGIVQGYKSRFLIDEDGQSMP
TRSISAGLDYMGIGPQLAALGESGRVEFTAILDKEALEAVKFFARNEGILFALESAHAGA
AAMKIAKELPKDKALVINMSGRGDKDIFITSPVFRPEKWKEFLKAELVRLENNEDIHDAE
IMTRK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacctctacaacttctaacaacggtttctttgacaagttcggcggcaagtacgttgcc
gaaatcatccgccgcccgctcgacgacctcgaagcggcattcaacaagtacatccacgat
ccggaatttctcgaagaactccgcatcatccagcgcgactacattggccgcgaaactccg
ctgtactttgccccgacggcaaccaagctcttgggcggtgcgcagatttacatcaagctc
gaaggtctcgccaacacaggcgcccacaaaatcaacaacgctatcggtcagtgccttttg
gccaagaagatgggcaagacccgcatcatcgccgaaacgggcgccggccagcatggcctc
gccactgctgccgcttgcgcaaagctcggcctcgaatgcgtcgtgtacatgggtgaagtc
gatgtccgtcgtcagcagccgaacgtagcaacgatggaaatgtacggtgcaaaggtcgtg
ccggtcacaagcggtagccgcacactcaaggatgccgtgaacgaagctatgcgtgactgg
gccacaaacttccagaacacgcactatgtgctcggctccgcactcggccctgccccgttc
ccggatatcgttcgcaccttccagtccatcatcggtgaagaagtcaagcgccaggccgcc
gaacgcaacatcgacatcgcagccgttgtcgcttgcgtgggtggcggtagcaactccatc
ggtgtgttcactccgtttatcgaagacaagaatgtacgattgattggtgcagaagccggt
ggcgttggcccgaatgtcggtgaaaacgcagcccgcatgacgggtaacgcaagccgcgaa
ggcatcgtgcagggttacaagagccgcttcctcattgacgaagacggtcaatccatgccg
acgcgctccatttcggcaggtctcgactatatgggcattggcccgcagctcgccgctctc
ggtgaatctggccgcgtggaattcacggcaattctcgacaaggaagctcttgaagccgtc
aagttcttcgcccgtaacgaaggcattttgttcgcactcgaaagcgctcacgccggtgca
gccgccatgaagatcgcgaaggaactcccgaaagacaaggcgctcgtcatcaacatgagt
ggccgcggtgacaaggacatcttcatcacaagcccggtgttccgccccgaaaagtggaag
gaattcctcaaggcagaacttgttcgcctcgaaaacaacgaagacatccacgacgctgaa
attatgacaaggaagtaa

DBGET integrated database retrieval system