KEGG   Fibrobacter succinogenes: Fisuc_0179Help
Entry
Fisuc_0179        CDS       T01099                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fsu  Fibrobacter succinogenes
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fsu01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:fsu00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:fsu00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
206011..207288
Genome map
AA seq 425 aa AA seqDB search
MTSTTSNNGFFDKFGGKYVAEIIRRPLDDLEAAFNKYIHDPEFLEELRIIQRDYIGRETP
LYFAPTATKLLGGAQIYIKLEGLANTGAHKINNAIGQCLLAKKMGKTRIIAETGAGQHGL
ATAAACAKLGLECVVYMGEVDVRRQQPNVATMEMYGAKVVPVTSGSRTLKDAVNEAMRDW
ATNFQNTHYVLGSALGPAPFPDIVRTFQSIIGEEVKRQAAERNIDIAAVVACVGGGSNSI
GVFTPFIEDKNVRLIGAEAGGVGPNVGENAARMTGNASREGIVQGYKSRFLIDEDGQSMP
TRSISAGLDYMGIGPQLAALGESGRVEFTAILDKEALEAVKFFARNEGILFALESAHAGA
AAMKIAKELPKDKALVINMSGRGDKDIFITSPVFRPEKWKEFLKAELVRLENNEDIHDAE
IMTRK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacctctacaacttctaacaacggtttctttgacaagttcggcggcaagtacgttgcc
gaaatcatccgccgcccgctcgacgacctcgaagcggcattcaacaagtacatccacgat
ccggaatttctcgaagaactccgcatcatccagcgcgactacattggccgcgaaactccg
ctgtactttgccccgacggcaaccaagctcttgggcggtgcgcagatttacatcaagctc
gaaggtctcgccaacacaggcgcccacaaaatcaacaacgctatcggtcagtgccttttg
gccaagaagatgggcaagacccgcatcatcgccgaaacgggcgccggccagcatggcctc
gccactgctgccgcttgcgcaaagctcggcctcgaatgcgtcgtgtacatgggtgaagtc
gatgtccgtcgtcagcagccgaacgtagcaacgatggaaatgtacggtgcaaaggtcgtg
ccggtcacaagcggtagccgcacactcaaggatgccgtgaacgaagctatgcgtgactgg
gccacaaacttccagaacacgcactatgtgctcggctccgcactcggccctgccccgttc
ccggatatcgttcgcaccttccagtccatcatcggtgaagaagtcaagcgccaggccgcc
gaacgcaacatcgacatcgcagccgttgtcgcttgcgtgggtggcggtagcaactccatc
ggtgtgttcactccgtttatcgaagacaagaatgtacgattgattggtgcagaagccggt
ggcgttggcccgaatgtcggtgaaaacgcagcccgcatgacgggtaacgcaagccgcgaa
ggcatcgtgcagggttacaagagccgcttcctcattgacgaagacggtcaatccatgccg
acgcgctccatttcggcaggtctcgactatatgggcattggcccgcagctcgccgctctc
ggtgaatctggccgcgtggaattcacggcaattctcgacaaggaagctcttgaagccgtc
aagttcttcgcccgtaacgaaggcattttgttcgcactcgaaagcgctcacgccggtgca
gccgccatgaagatcgcgaaggaactcccgaaagacaaggcgctcgtcatcaacatgagt
ggccgcggtgacaaggacatcttcatcacaagcccggtgttccgccccgaaaagtggaag
gaattcctcaaggcagaacttgttcgcctcgaaaacaacgaagacatccacgacgctgaa
attatgacaaggaagtaa

DBGET integrated database retrieval system