KEGG   Fibrobacter succinogenes: Fisuc_0180Help
Entry
Fisuc_0180        CDS       T01099                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fsu  Fibrobacter succinogenes
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fisuc_0180
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fisuc_0180
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Fisuc_0180
Enzymes [BR:fsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Fisuc_0180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
207294..208046
Genome map
AA seq 250 aa AA seqDB search
MNLMSHLIAGFPDAETSIAIADALVKGGANILEIQLAFSDPSADGPAIQTASTIALEKGY
STKQGLAIVKQIHERHPETPIYIMTYGSLAFTPGVENFVKMCKDAGVSACIIPDLPFDHD
EGLTEACKKHGLENIPVAAPSMTKERLETMASAGFKYIYAALRAGTTGSETTIDQATLDF
IDTVGKHGAKVLGGFGIRNGEQSKVLSKHVYAVVAGSVFVNIVLANADTAEGRAKAIAAI
EAKAKEIAGK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaatgtctcatcttattgcgggttttcctgacgctgaaacttctatcgccatc
gccgacgcacttgtgaagggtggcgccaacatccttgaaatccagctcgcgttcagtgac
ccgagcgcagacggtccagccatccagacagcctccaccatcgctctcgaaaaaggctat
tccaccaagcagggccttgccatcgtgaagcagattcacgaacgccaccctgaaacgccg
atttacatcatgacttacggttccctcgcctttacgccgggcgtcgaaaactttgtcaag
atgtgcaaggacgcaggcgtttctgcttgcatcattccggaccttccgtttgaccatgac
gaaggcctcaccgaagcttgcaagaagcacggtctcgaaaacattccggttgccgctccg
agcatgaccaaggaacgtctcgaaacgatggcttctgcaggtttcaagtacatctacgcc
gcactccgcgcaggcacgaccggaagcgaaacaacgattgaccaggcaacgcttgacttt
atcgacacagtcggtaagcatggcgccaaggttctcggtggtttcggcatccgcaatggc
gaacagtccaaggtgctttcgaagcatgtgtacgctgtggtcgcaggttccgtcttcgtg
aacatcgtgctcgcaaacgcagacaccgccgaaggccgcgcaaaagccatcgccgctatc
gaagctaaggccaaggaaatcgccggaaagtaa

DBGET integrated database retrieval system