KEGG   Fibrobacter succinogenes: Fisuc_0180Help
Entry
Fisuc_0180        CDS       T01099                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fsu  Fibrobacter succinogenes
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fisuc_0180
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fisuc_0180
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Fisuc_0180
Enzymes [BR:fsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Fisuc_0180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
207294..208046
Genome map
AA seq 250 aa AA seqDB search
MNLMSHLIAGFPDAETSIAIADALVKGGANILEIQLAFSDPSADGPAIQTASTIALEKGY
STKQGLAIVKQIHERHPETPIYIMTYGSLAFTPGVENFVKMCKDAGVSACIIPDLPFDHD
EGLTEACKKHGLENIPVAAPSMTKERLETMASAGFKYIYAALRAGTTGSETTIDQATLDF
IDTVGKHGAKVLGGFGIRNGEQSKVLSKHVYAVVAGSVFVNIVLANADTAEGRAKAIAAI
EAKAKEIAGK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaatgtctcatcttattgcgggttttcctgacgctgaaacttctatcgccatc
gccgacgcacttgtgaagggtggcgccaacatccttgaaatccagctcgcgttcagtgac
ccgagcgcagacggtccagccatccagacagcctccaccatcgctctcgaaaaaggctat
tccaccaagcagggccttgccatcgtgaagcagattcacgaacgccaccctgaaacgccg
atttacatcatgacttacggttccctcgcctttacgccgggcgtcgaaaactttgtcaag
atgtgcaaggacgcaggcgtttctgcttgcatcattccggaccttccgtttgaccatgac
gaaggcctcaccgaagcttgcaagaagcacggtctcgaaaacattccggttgccgctccg
agcatgaccaaggaacgtctcgaaacgatggcttctgcaggtttcaagtacatctacgcc
gcactccgcgcaggcacgaccggaagcgaaacaacgattgaccaggcaacgcttgacttt
atcgacacagtcggtaagcatggcgccaaggttctcggtggtttcggcatccgcaatggc
gaacagtccaaggtgctttcgaagcatgtgtacgctgtggtcgcaggttccgtcttcgtg
aacatcgtgctcgcaaacgcagacaccgccgaaggccgcgcaaaagccatcgccgctatc
gaagctaaggccaaggaaatcgccggaaagtaa

DBGET integrated database retrieval system