KEGG   Fibrobacter succinogenes: Fisuc_0180Help
Entry
Fisuc_0180        CDS       T01099                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fsu  Fibrobacter succinogenes
Pathway
fsu00260  Glycine, serine and threonine metabolism
fsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fsu01100  Metabolic pathways
fsu01110  Biosynthesis of secondary metabolites
fsu01130  Biosynthesis of antibiotics
fsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fisuc_0180
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Fisuc_0180
Enzymes [BR:fsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Fisuc_0180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ACX73794
JGI: Fisuc_0180
UniProt: C9RJT1
Position
207294..208046
Genome map
AA seq 250 aa AA seqDB search
MNLMSHLIAGFPDAETSIAIADALVKGGANILEIQLAFSDPSADGPAIQTASTIALEKGY
STKQGLAIVKQIHERHPETPIYIMTYGSLAFTPGVENFVKMCKDAGVSACIIPDLPFDHD
EGLTEACKKHGLENIPVAAPSMTKERLETMASAGFKYIYAALRAGTTGSETTIDQATLDF
IDTVGKHGAKVLGGFGIRNGEQSKVLSKHVYAVVAGSVFVNIVLANADTAEGRAKAIAAI
EAKAKEIAGK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaatgtctcatcttattgcgggttttcctgacgctgaaacttctatcgccatc
gccgacgcacttgtgaagggtggcgccaacatccttgaaatccagctcgcgttcagtgac
ccgagcgcagacggtccagccatccagacagcctccaccatcgctctcgaaaaaggctat
tccaccaagcagggccttgccatcgtgaagcagattcacgaacgccaccctgaaacgccg
atttacatcatgacttacggttccctcgcctttacgccgggcgtcgaaaactttgtcaag
atgtgcaaggacgcaggcgtttctgcttgcatcattccggaccttccgtttgaccatgac
gaaggcctcaccgaagcttgcaagaagcacggtctcgaaaacattccggttgccgctccg
agcatgaccaaggaacgtctcgaaacgatggcttctgcaggtttcaagtacatctacgcc
gcactccgcgcaggcacgaccggaagcgaaacaacgattgaccaggcaacgcttgacttt
atcgacacagtcggtaagcatggcgccaaggttctcggtggtttcggcatccgcaatggc
gaacagtccaaggtgctttcgaagcatgtgtacgctgtggtcgcaggttccgtcttcgtg
aacatcgtgctcgcaaacgcagacaccgccgaaggccgcgcaaaagccatcgccgctatc
gaagctaaggccaaggaaatcgccggaaagtaa

DBGET integrated database retrieval system