KEGG   Fibrobacter succinogenes: Fisuc_0190Help
Entry
Fisuc_0190        CDS       T01099                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
fsu  Fibrobacter succinogenes
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fsu01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:fsu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(222215..223354)
Genome map
AA seq 379 aa AA seqDB search
MSELRKNILDEARRVVVKIGSRILVDSERGGVRTRYIQKLADSVARLMDAGKEVVIVTSG
AVGTGMAELGYAQKPTVLAEKQACAAVGQIDLMYAYREMFRWVQLSVGQILLSAEDFRDR
ARYKNLQNTIKAMLARKIVPIINENDSLAVAEIKVGDNDKLSSDVALFLDADLLLIFTDE
DGLFDDNPKKNPNARLLNFVPEITPAILALAGKPGEAGSAVSTGGMRSKLEAIRNVTKSG
ANAFLASGMKVLPHQVFFENATGTLFAGSKKKLNSRQRWLSFITTPRGSVIVDEGGVKAL
RENHSSLLPVGVIAVQKHFDKGDLIEVQDEKKNPVARGVAGFDSETLKLVLRKKTAQVHE
ILGKNVPDELIHKNDLVVF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaattaagaaagaacattttagatgaagctcgccgcgtggtggtgaagattggt
tctcgtattctcgtggattccgagcgaggtggcgttcgtacacgttatatccagaagctt
gcggattccgtggctcgcttgatggatgccggcaaggaagtcgtcattgtcacgagtggt
gctgtgggtacaggcatggctgaactgggttacgctcaaaagccgaccgtgcttgccgaa
aagcaggcttgcgctgccgtgggtcagattgacctcatgtacgcttatcgcgaaatgttc
cgctgggtgcaactctccgttggccagatcctcttgtctgcagaagacttccgcgaccgc
gcgcgttacaagaatttgcagaacaccatcaaggccatgcttgcccgtaagattgttccg
atcattaacgagaacgattccttagccgttgccgaaatcaaggtgggcgataacgacaag
ctctcgagcgatgtggcgctcttccttgatgctgacttgctcctcatctttacggatgaa
gacggcttgttcgatgacaatccgaagaagaatccgaacgctcgcttgttgaactttgtt
cctgaaattacgcctgcgattttggcattggccggaaagcccggcgaggccgggtccgcc
gtcagtaccggcggcatgaggagcaagctcgaagccattcgcaatgtgacgaagagcggc
gcgaatgcattccttgctagcggtatgaaggtcctcccgcatcaggtattctttgaaaat
gcaacaggaactttgttcgcaggctccaagaaaaaactcaatagccgtcagcgctggctc
agcttcattacgacgccgcgtggaagcgtgattgtcgatgaaggcggtgtgaaggctttg
cgtgaaaatcattcgagcttgttgccggtgggcgtgattgcggtacagaagcattttgat
aagggcgacttgattgaagtccaggacgaaaagaagaatcctgtagctcgcggtgtcgct
ggttttgatagcgaaacgcttaagcttgtgctccgtaagaagactgcccaggtgcatgaa
atcttgggcaagaacgttcctgatgaacttatccacaagaacgacttggttgtattctaa

DBGET integrated database retrieval system