KEGG   Fibrobacter succinogenes: Fisuc_0569Help
Entry
Fisuc_0569        CDS       T01099                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
fsu  Fibrobacter succinogenes
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Fisuc_0569
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Fisuc_0569
Enzymes [BR:fsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Fisuc_0569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(661183..662604)
Genome map
AA seq 473 aa AA seqDB search
MISEGLMQKLSVTGLCDDSRRVKPGNLFFSIPAEGYEAFARSAIAAGAVAVVGETMAPEG
LTSKWIQVPDVKAARLEAAKIFYKDPFSKLICHAITGTNGKTTSAFLMNAMLEAEGRKTA
LLGTIKNKIGDKSVPASLTTPGLLDLYEFASRAVAEGCTDLVMEASSHSLHQGRVAGIRF
RSGLFSNLTQDHLDYHKTMDAYFEAKKLLFTKYLAENGVAVINIDDAHGEKLFNALDCRK
VAVSRLGKAKADVKPFGEIKSTEDGLEFTLPMIATDKFETPLCGDFNVDNLLLVLAWAHA
LCVPEDAMRKAITTVRVPGRFEKVWSKDGKHVIVDYAHTPDALERVLNVARSLCRGKLST
VFGCGGDRDKTKRPIMGGIAERIADKAWLTSDNPRTEKPADIIADVRAGMTTDKFEVVEN
REEAINRACAELKSGDWLVIAGKGHEDYQIIGKTKHHFDDREIAVKAMTDAEA
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgatttcggaaggactgatgcaaaagttgtccgtgacggggctttgtgatgattcccgc
cgtgtgaaaccggggaatttgttcttctccattccggcggaaggctatgaggcttttgcc
cgcagtgccatagcggctggtgccgttgcggttgtgggcgagacgatggctcccgaagga
ctcacgtctaagtggatccaggtgccggacgtgaaggcagcccgcctcgaagcggccaag
attttctacaaggatccgttcagcaagcttatctgccatgccattacgggtacgaacggc
aagacgacaagtgcattccttatgaatgcgatgcttgaagcggaaggccgcaagaccgct
ctgctcggcaccatcaagaataagattggcgacaagtccgtgccggcttcgcttacgact
ccgggtcttttggacctttatgaatttgcatctcgcgctgtagctgaaggctgcactgac
ctcgtgatggaagcgtcttcgcattcgctccaccagggccgtgttgccggtattcgtttc
agaagcggtctctttagcaacttgacgcaggaccatctcgattaccacaagacgatggat
gcctacttcgaagccaagaagttgctctttacgaagtacctcgctgaaaatggcgtggct
gtcatcaatattgatgatgctcacggcgaaaagcttttcaacgctctcgattgccgcaag
gtcgctgtttcgagacttggcaaggccaaggctgacgtgaagccgtttggcgaaatcaag
agcactgaagacggccttgaattcacgcttccgatgattgcaacggataagtttgaaact
ccgctctgcggcgactttaacgtggacaacctgctcctggtgcttgcatgggctcatgct
ctctgcgtacctgaagatgccatgcgcaaggcgattacgactgtgcgcgttccgggccgt
tttgaaaaggtctggagcaaggacggcaagcatgtgattgtggactacgctcacacgccg
gatgcccttgaacgcgtgctgaatgtggctcgtagcctctgccgcggcaagctttcaacc
gtgtttggctgcggtggtgaccgcgacaagacgaagcgtccgattatgggcggcattgca
gaacgcattgcagacaaggcttggctcacgtcggacaatccgcgtaccgaaaagcctgca
gatattatcgctgacgttcgcgccggcatgacgacggacaagtttgaagtggtcgaaaac
cgcgaagaagctatcaatcgcgcttgtgcagaactcaagagcggcgactggcttgtgatt
gcgggcaagggccatgaggattaccagatcattggtaagaccaaacatcattttgacgat
cgcgaaatcgcggtgaaggcgatgactgatgctgaagcttga

DBGET integrated database retrieval system