KEGG   Fibrobacter succinogenes: Fisuc_0754Help
Entry
Fisuc_0754        CDS       T01099                                 

Definition
(GenBank) Endo-1,4-beta-xylanase
  KO
K01181  endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
fsu  Fibrobacter succinogenes
Brite
Enzymes [BR:fsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Fisuc_0754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_10 Glyco_hydro_1 ATP-synt_C
Motif
Other DBs
NCBI-ProteinID: ACX74364
JGI: Fisuc_0754
Position
903597..905015
Genome map
AA seq 472 aa AA seqDB search
MSLKKTFSGIALGAALLGAGISSAYAADETLRSLADKNGIYIGAILNSQWFGGGLPGNYE
QIHKSQFNIVVAENEMKFDATEPQEGRFNYNNGDKMVRYAQQNGMRVRGHALAWHSQVPG
WVNNYKNDKKKLLAVLKNHIEKVVGHWKGQVAEWDVVNEAISNNEPQWRTGSVWYQGIGP
EFIDSAFVWAHAVDPDAELCYNDYNLEQGVNPKAKAGFLLEQVKRWVKNGIPIHCVGSQT
HVEDTTTDKHFIGSPDSLRSLAKELAKLNVKLKITELDIGFKSGINVSKSDLERQGQTFR
QYLDIILEEPNADTYLIWGVSDKWSWLGGLNRQKGLIYDDNLKPKPAFDSILVRLQTYEP
PKDSVKQDSVAQDSIKKDSTAKDSTKKDSTDAIAKIASRTTMSAYVAGRTLFVTGLVSKT
AAKVDLFDMQGRPVFSTKCENGMVDLKDIAEGLYVVQIRSGSNKIVQRVNVK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaagaaaactttttcagggattgcacttggtgcagcccttcttggcgcaggt
atatcaagtgcctacgctgctgacgaaacactaagatcccttgcagataaaaacggaatc
tacatcggcgcgattctgaactcgcaatggttcggcggaggccttcctggcaattacgaa
cagatccacaaatcccaattcaacatcgtcgttgccgaaaacgagatgaagttcgacgcc
accgaaccgcaagaagggagattcaattacaacaatggcgacaagatggtccgttacgca
cagcaaaacggaatgcgcgtccgcggccacgccctcgcctggcacagccaagttccgggc
tgggtaaacaactacaagaacgataaaaagaaattgctcgccgttctcaagaaccacatc
gaaaaggttgtcggccactggaaaggtcaagtcgctgaatgggacgtggtgaacgaagcc
atcagcaacaacgaaccccaatggcgtacaggttccgtgtggtaccagggtatcggtccg
gaattcatcgattccgccttcgtatgggctcacgctgtagacccggatgcagaactctgc
tataacgactacaacctcgaacagggcgtcaatccgaaagccaaggcaggatttttgcta
gaacaggtgaagcgctgggtcaaaaacggcattcctatccattgcgtgggttcccaaaca
cacgtggaagacaccaccaccgacaagcactttatcggttcaccggatagcctccgctcc
ctcgccaaggaacttgcaaaactcaatgtcaagctgaaaatcaccgaactcgatatcgga
ttcaagagcggcatcaatgtcagcaagagcgaccttgaacgtcagggacaaacattccgt
caatacctcgacattatcctcgaagaaccgaatgcggacacgtatctgatttggggtgtt
tctgataaatggagctggcttggcggcctgaacagacagaaaggccttatctacgatgac
aatctgaagccgaagcctgcattcgatagcatcttggtgagactccaaacttacgaacct
cccaaggattccgtcaagcaggattccgttgcacaagactccatcaagaaggattcgaca
gccaaggattctacgaaaaaggactctacagacgccatcgcaaaaatcgccagcagaacg
acgatgtccgcatacgttgctggccgcacattgttcgtaacgggattggtttctaagacc
gccgcaaaggtcgacttgttcgatatgcaaggccgccccgtgttcagcaccaagtgtgaa
aatggaatggtggacttgaaggatattgccgaagggctttacgtggtgcagatacgctca
ggcagcaacaagatagtgcaacgcgtgaacgtgaagtaa

DBGET integrated database retrieval system