KEGG   Fibrobacter succinogenes: Fisuc_0873Help
Entry
Fisuc_0873        CDS       T01099                                 

Definition
glucosamine/fructose-6-phosphate aminotransferase
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
fsu  Fibrobacter succinogenes
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Fisuc_0873
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Fisuc_0873
Enzymes [BR:fsu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     Fisuc_0873
Peptidases [BR:fsu01002]
 Cysteine Peptidases
  Family C44
   Fisuc_0873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1089330..1091159
Genome map
AA seq 609 aa AA seqDB search
MCGIIGYNGKGEALPVLVEGLKKMEYRGYDSSGVAVIDNGQIKVVRASGKIKALEDKLKT
TPLKGSIGIAHTRWATHGAPTETNAHPHTSYDGKISIVHNGIIENYASLKAKLISEGIEF
KSETDTEVVAHLIARYYNGDLKSAVLKALKQIEGTFGLGVVCSDEPNVLIGARRGSPLIL
GIGNDGDFYLASDVSAIINHTQKVVYLDDNDVVQIKDGGYSIVNMSSHEVQREVQDVEFD
ADAVAKGGFPHFMLKEIFEQPEVLRNTMRGRLLTAEGNAKLAGLDTNIKELRNINRIIIT
ACGTSYYAGMVGEYMIEDLAGVPVEVEYASEFRYRNPIIKPGTLVIAISQSGETADTLAA
LREAQQKGATALAICNGVGSTIARTSDGGVYLHAGPEIGVASTKAFTSQVTVLAMIALLL
GRQRRLSFETGADIVKDLLELPDLVTETLKLSDSIAEIAKTLCKANNFLYLGRHFCYPVA
MEGALKLKEISYIHAEGYPAAEMKHGPIALIDENMPVVVIAPKDSLFDKIISNIREIKAR
GGKVIAVTTEDCHPLDEIADHIITVPKTRPMLMPILACIPLQLLAYHIAVLRGNDVDQPR
NLAKSVTVE
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattatcggatataatggaaaaggggaagctttaccggtcctcgtcgaagga
ctcaagaaaatggaataccgaggctatgatagctcaggtgttgccgtcattgataacggt
caaataaaagttgtccgtgcatccggaaaaatcaaggctctcgaagacaaattaaagacc
accccgctcaagggttctattggcattgcccacacgcgctgggccacccatggcgccccc
accgaaacaaacgcacaccctcatacaagctatgacggaaagatttcgattgtccacaac
ggcattatcgaaaactacgcaagcctcaaggcgaagctcatctccgaaggtattgaattc
aagtctgagaccgataccgaagtcgtagcccacctgattgcacgctattacaatggcgac
ctcaaatccgccgtactcaaggctctcaagcagattgaaggtactttcggtcttggcgtt
gtttgcagcgacgaaccgaacgtcttgattggcgcccgccgtggaagtcctctcattttg
ggtatcggaaacgatggcgatttctacctcgcgagtgacgtttccgccatcatcaaccac
acgcagaaagtcgtttaccttgatgacaacgacgttgtccaaatcaaggatggcggctat
tccatcgtgaacatgagcagccacgaagtgcagcgcgaagtccaggacgtggaattcgac
gccgatgcagtcgccaagggcggattcccgcacttcatgctcaaggaaattttcgaacag
cccgaagtattgcgcaataccatgcgcggtcgtttgctcaccgccgaaggcaacgcaaag
ctcgctggcctcgacacgaacatcaaggaactccgtaacatcaaccgcatcatcatcacc
gcctgcggcacaagctactatgcaggcatggtcggtgaatacatgattgaagacttggct
ggcgtcccggtcgaagtcgaatacgcttcggaattccgctacagaaacccgattatcaag
ccgggaactctcgtcattgccatcagccagtccggcgaaactgcagatacgctcgccgct
ctccgcgaagcccagcagaaaggcgcaaccgcactcgccatctgtaacggtgtcggttcg
acgatcgctcgcacaagcgacggtggcgtctacctgcacgccggtccggaaatcggcgtg
gccagcaccaaggctttcacaagccaggtgaccgtgctcgccatgattgccctcttgctc
ggccgccaacgcagactcagctttgaaacaggcgccgacatcgtgaaggaccttttggaa
cttccggatctcgtgacggaaacgctcaagctctccgacagcatcgccgaaattgccaag
acgctctgcaaggcaaacaacttcttgtacctcggtcgccacttctgctacccggtcgcc
atggaaggcgctttgaagctcaaggaaatcagctacatccacgccgaaggctaccccgct
gcagaaatgaagcacggtccgattgcccttatcgacgaaaacatgccggtcgtggtcatc
gccccgaaggattcgctcttcgacaagatcatcagcaatatccgcgaaatcaaggctcgc
ggaggcaaggtcatcgccgtcacgacggaagattgccacccacttgacgaaatcgctgac
cacatcatcacagtcccgaagacccgcccgatgctcatgccgattctcgcctgcattccg
ctccagttgctcgcctaccacatcgccgtgttgcgcggaaacgacgtggaccagccgaga
aaccttgccaagagcgtgacggtggaataa

DBGET integrated database retrieval system