KEGG   Fibrobacter succinogenes: Fisuc_0873Help
Entry
Fisuc_0873        CDS       T01099                                 

Definition
glucosamine/fructose-6-phosphate aminotransferase
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
fsu  Fibrobacter succinogenes
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:fsu00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:fsu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1089330..1091159
Genome map
AA seq 609 aa AA seqDB search
MCGIIGYNGKGEALPVLVEGLKKMEYRGYDSSGVAVIDNGQIKVVRASGKIKALEDKLKT
TPLKGSIGIAHTRWATHGAPTETNAHPHTSYDGKISIVHNGIIENYASLKAKLISEGIEF
KSETDTEVVAHLIARYYNGDLKSAVLKALKQIEGTFGLGVVCSDEPNVLIGARRGSPLIL
GIGNDGDFYLASDVSAIINHTQKVVYLDDNDVVQIKDGGYSIVNMSSHEVQREVQDVEFD
ADAVAKGGFPHFMLKEIFEQPEVLRNTMRGRLLTAEGNAKLAGLDTNIKELRNINRIIIT
ACGTSYYAGMVGEYMIEDLAGVPVEVEYASEFRYRNPIIKPGTLVIAISQSGETADTLAA
LREAQQKGATALAICNGVGSTIARTSDGGVYLHAGPEIGVASTKAFTSQVTVLAMIALLL
GRQRRLSFETGADIVKDLLELPDLVTETLKLSDSIAEIAKTLCKANNFLYLGRHFCYPVA
MEGALKLKEISYIHAEGYPAAEMKHGPIALIDENMPVVVIAPKDSLFDKIISNIREIKAR
GGKVIAVTTEDCHPLDEIADHIITVPKTRPMLMPILACIPLQLLAYHIAVLRGNDVDQPR
NLAKSVTVE
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattatcggatataatggaaaaggggaagctttaccggtcctcgtcgaagga
ctcaagaaaatggaataccgaggctatgatagctcaggtgttgccgtcattgataacggt
caaataaaagttgtccgtgcatccggaaaaatcaaggctctcgaagacaaattaaagacc
accccgctcaagggttctattggcattgcccacacgcgctgggccacccatggcgccccc
accgaaacaaacgcacaccctcatacaagctatgacggaaagatttcgattgtccacaac
ggcattatcgaaaactacgcaagcctcaaggcgaagctcatctccgaaggtattgaattc
aagtctgagaccgataccgaagtcgtagcccacctgattgcacgctattacaatggcgac
ctcaaatccgccgtactcaaggctctcaagcagattgaaggtactttcggtcttggcgtt
gtttgcagcgacgaaccgaacgtcttgattggcgcccgccgtggaagtcctctcattttg
ggtatcggaaacgatggcgatttctacctcgcgagtgacgtttccgccatcatcaaccac
acgcagaaagtcgtttaccttgatgacaacgacgttgtccaaatcaaggatggcggctat
tccatcgtgaacatgagcagccacgaagtgcagcgcgaagtccaggacgtggaattcgac
gccgatgcagtcgccaagggcggattcccgcacttcatgctcaaggaaattttcgaacag
cccgaagtattgcgcaataccatgcgcggtcgtttgctcaccgccgaaggcaacgcaaag
ctcgctggcctcgacacgaacatcaaggaactccgtaacatcaaccgcatcatcatcacc
gcctgcggcacaagctactatgcaggcatggtcggtgaatacatgattgaagacttggct
ggcgtcccggtcgaagtcgaatacgcttcggaattccgctacagaaacccgattatcaag
ccgggaactctcgtcattgccatcagccagtccggcgaaactgcagatacgctcgccgct
ctccgcgaagcccagcagaaaggcgcaaccgcactcgccatctgtaacggtgtcggttcg
acgatcgctcgcacaagcgacggtggcgtctacctgcacgccggtccggaaatcggcgtg
gccagcaccaaggctttcacaagccaggtgaccgtgctcgccatgattgccctcttgctc
ggccgccaacgcagactcagctttgaaacaggcgccgacatcgtgaaggaccttttggaa
cttccggatctcgtgacggaaacgctcaagctctccgacagcatcgccgaaattgccaag
acgctctgcaaggcaaacaacttcttgtacctcggtcgccacttctgctacccggtcgcc
atggaaggcgctttgaagctcaaggaaatcagctacatccacgccgaaggctaccccgct
gcagaaatgaagcacggtccgattgcccttatcgacgaaaacatgccggtcgtggtcatc
gccccgaaggattcgctcttcgacaagatcatcagcaatatccgcgaaatcaaggctcgc
ggaggcaaggtcatcgccgtcacgacggaagattgccacccacttgacgaaatcgctgac
cacatcatcacagtcccgaagacccgcccgatgctcatgccgattctcgcctgcattccg
ctccagttgctcgcctaccacatcgccgtgttgcgcggaaacgacgtggaccagccgaga
aaccttgccaagagcgtgacggtggaataa

DBGET integrated database retrieval system