KEGG   Fibrobacter succinogenes: Fisuc_1146Help
Entry
Fisuc_1146        CDS       T01099                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
fsu  Fibrobacter succinogenes
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Fisuc_1146
DNA repair and recombination proteins [BR:fsu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Fisuc_1146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1408535..1409131
Genome map
AA seq 198 aa AA seqDB search
MNVEPQSLENLISEFASLPGIGLKTARRLAYHMLSRKKGDVERFADSLMQAAEKVHPCPR
CHAFTDEDICPTCRAREGAKSICVVEKNSDILPFERSSVHKGLYFVLGGVISPLDGIGPE
ALHLPQLVERIKAENIEELVLALGSSPEADSTALMIDRMLAGVNVKRTRLARGIPMGSDL
EFIDEVTMLRAFEGRVSL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtagaaccgcaaagcctagaaaacctgatttctgaatttgcctcccttccaggg
attggactaaagacggcacgccgcctcgcctaccacatgctttcgcgcaaaaaaggcgat
gtcgagcgctttgccgatagcttgatgcaggccgccgaaaaggtccacccgtgcccgcgc
tgccacgccttcaccgacgaagacatctgccctacgtgcagagcccgcgaaggcgccaag
tccatctgcgttgtcgaaaaaaattcagacattctgccgttcgaacgttcgtctgtccat
aaaggtctttactttgtcctcggcggtgtgatttccccgctcgacggcatcggccccgaa
gcactccacctgccgcaactcgtggaacgcatcaaagcagaaaacatcgaagaacttgtc
cttgcactcggctctagccccgaagccgacagcacagccctcatgattgaccgcatgctc
gccggcgtcaatgtcaagcgcacccgccttgcccgcggcatcccgatgggcagcgacctg
gaattcatcgacgaagtcaccatgcttcgcgcattcgaagggagagtttccttatga

  All links  
No link information was found.   
DBGET integrated database retrieval system