KEGG   Fibrobacter succinogenes: Fisuc_1224Help
Entry
Fisuc_1224        CDS       T01099                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
fsu  Fibrobacter succinogenes
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Fisuc_1224
Enzymes [BR:fsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Fisuc_1224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1511253..1513487
Genome map
AA seq 744 aa AA seqDB search
MKLTKLLTSILAGAAISAFAADASTATPKKVGPVSYYGALHTSGSKIIGAKNNQQVMLRG
VSLFWSDATGLSYYNPTVISWVVDNLKIDVFRYAMGIEYYDSNGGTKNKLDDQVSYTKSP
EGQLSTIDRMVQAAIENDVYIVIDWHSHRAHLETNLAKDFFAKISQKYKDVPNIIYEIYN
EPVSGSGGDWGAIKNYANSVVPAIRTNTQNLIIVGTPNWSQHPEQGARDPIQSTNIAYVL
HFYASSHSKGSFGGYVSSALSAGYPVFISEWGTTNADGDGEPNSSATNEWTQFMDQNMIP
NCNWSLRQQTSDVDQKSEKSAIFAGDKSLITAAALDAATFTSSGNIIKSYLTKNARSWAD
SLVKGKSGSCSFKATTAKQTDGKISGVLKSGCTYTSSNEKVASASGSDIVVGDYGFAILT
GNDGSQSIVTVKQVAGQTITNLSDITCNFSGSCTAASKNGMSRDFDGDGTKDYLLTMDDK
TNEGSKFTLTSLDPTTVSVSKNKCTNANCSNSQKNQQVWMLHFHKYGTAKVVASAPAITG
FRAMQDTFEITYKKGSYNMNNKFKDQTIALGGTTTEGFPDALLGNAVTYTFNGQPTTPYL
TKVGNAFVGGAQNAIFAITAHIAETADYEEFERTVTVIVGDAGTAVNLAEWIAYTNPIDA
IKPANKIVNSFNARMDGSMLQFTTKNTGLVKVDIYDALGASVKQMSEVYGKGSHAIDLKG
LPNGSYTLVVRQGSQKASIRWVNK
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgacaaagcttctgacaagcatcttggcaggcgcggcaatatccgcctttgca
gccgatgcatcgacagcaacccccaagaaagttgggccggtctcttattatggcgctctc
catacaagcggcagtaagatcattggcgccaagaacaaccagcaggtcatgctccgcggt
gtgagccttttctggtccgacgcaacgggtctttcttactataacccaaccgtcatttca
tgggttgtagacaatctcaaaattgacgtgttccgctatgccatgggtattgaatactac
gactccaatggcggcaccaagaacaagctggacgatcaggtttcttatacgaagtccccg
gaaggccagctctccaccatcgacagaatggtccaggctgctatcgaaaacgacgtctat
atcgtcatcgactggcatagccacagagctcacctcgaaacaaacctcgccaaggacttc
ttcgccaagatttcccagaaatacaaagatgtcccgaacatcatctacgaaatctacaac
gaaccggtcagcggtagcggtggcgactggggtgccatcaagaactacgccaactccgtc
gtgccggctatccgtaccaacacgcaaaacttgatcatcgtcggtacgccgaactggtcc
cagcatccggaacagggcgcaagagacccgatccaatccacgaacattgcttacgttttg
cacttctacgcctccagccactccaagggtagcttcggcggttacgtctctagcgcactc
agcgccggttatccggtgttcatctctgaatggggtaccaccaacgctgacggtgacggc
gaaccgaactccagcgcaacaaacgaatggactcagttcatggaccagaacatgattccg
aactgcaactggagcttgcgtcagcagacttccgatgtggaccagaagagtgaaaagtcc
gccatcttcgctggcgacaagtccctcatcacggccgcagccctcgatgcagcaactttc
acctcctcgggtaatatcatcaagagctacctcaccaagaacgcacgttcctgggcagac
tccctcgtcaagggcaagagcggcagctgctccttcaaggctacaacagccaagcagact
gacggcaagatttctggagtcctcaagtccggttgtacttacacctccagcaacgaaaag
gttgcttccgcttctggcagcgacatcgtcgtgggcgactatggtttcgccatcctcact
ggtaatgacggttctcagtctatcgtgacggtcaagcaagttgcaggccagaccatcacg
aacctctctgatatcacttgcaatttctccggtagctgcacggccgcctccaagaacggc
atgtctcgcgactttgacggtgacggtaccaaggactacctcctcaccatggacgacaag
accaatgaaggctccaagttcaccctcacttctcttgacccgacaaccgtttctgtaagc
aagaacaagtgcactaacgccaactgctccaactctcagaagaatcagcaagtttggatg
ttgcacttccacaagtacggcacagccaaggtcgttgcatctgcaccggcaattacaggc
ttccgcgccatgcaggacaccttcgaaatcacttacaagaagggttcctacaacatgaac
aacaagttcaaggatcagaccatcgctcttggcggaaccactacagaaggattcccggat
gcattgctcggcaacgccgttacctacacgttcaacggccagcccaccacgccttacttg
accaaggtcggcaacgccttcgtcggtggcgcccagaacgcaatcttcgctattacggcc
cacattgcagaaactgccgactacgaagaattcgaaagaactgtaacggttatcgttggc
gacgcaggcacggcagtcaacttggccgaatggattgcatacaccaacccgatcgacgcc
atcaagccggctaacaagattgtaaacagcttcaacgcccgcatggacggttcgatgctc
cagttcacgaccaagaacactggcctcgtgaaagttgacatctatgacgctctcggcgca
agcgtgaagcagatgtccgaagtctacggcaagggcagccacgctatcgacctcaagggt
ctcccgaacggctcctacacgctcgttgtccgccagggcagccagaaggcctccatccgc
tgggtgaacaagtaa

DBGET integrated database retrieval system