KEGG   Fibrobacter succinogenes: Fisuc_1322Help
Entry
Fisuc_1322        CDS       T01099                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fsu  Fibrobacter succinogenes
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:fsu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:fsu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:fsu00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:fsu00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:fsu00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:fsu00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:fsu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1636923..1638260
Genome map
AA seq 445 aa AA seqDB search
MTQDDIIKNPLDYDLSIETVGKGTLKSPMNGVPFVSENDKVSLTTDVNLISEYLAKGIPV
PSLEVAGPRQTIFHDPAWTRAGIVTCGGLCPGLNNVIKGLVQVLWFDYGVRNIFGIPYGY
RGLNPNYGYSPIVLDPDVVDAIQEDGGTILGSSRGMQDPAIMVDTLMRLNINVLFCIGGD
GTLRGAHAIAEEVKKRKQPISIIGIPKTIDNDLNLIDRTFGFETAVLSATDVITSAHIEA
NGAFNGLGLVKLMGRDSGFIAAYASLATTVVNICLVPEVPFTLDGLFKALESRYASGKTH
AVIAVAEGAGQELFKNQEERRDASGNILKNDIGEFLTHKIKEHFDSVGKEINIKYFDPSY
TVRSIPAKGTDAIFCFQLAENAVHAGMAGKTDMVVGSMNNVFSHVPIEYAVSERKKINPN
GPLWHAVLGITRQQDYFSGKGKRSK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggacgatatcatcaagaatccgttggattatgatctttccattgaaaccgtt
ggcaagggcacgcttaagtccccgatgaacggcgttcctttcgtttcggaaaacgacaag
gtcagccttaccactgacgtcaatctcatctctgaatacttagcgaagggtatcccggta
ccttcactcgaagtggccggccctcgacagacaattttccacgaccccgcctggacacgt
gcaggcatcgtcacatgcggtggtctctgcccaggtcttaacaacgtgatcaagggcctt
gtacaagtgctctggttcgactacggcgtgaggaacatcttcggtatcccgtacggctac
cgtggcttgaacccgaattacggttactcccccatcgtgcttgacccggatgtggtcgat
gccattcaggaagacggcggtacgattctcggtagctcccgcggcatgcaggacccggcc
atcatggtcgatacgctcatgcgactcaacatcaacgtgttgttctgcatcggtggtgac
ggtacgctccgtggcgcacatgctattgccgaagaagtcaagaagcgtaaacagcccatc
tcgattatcggcatcccgaagacgatcgataacgacttgaacttgatcgacaggacgttc
ggttttgaaaccgccgtgctcagcgccacagacgtgattaccagcgcccacattgaagca
aacggtgcattcaatggtcttggcctagtgaagctcatgggtcgtgactccggctttatc
gccgcgtatgcatcgcttgcaacaacagttgtgaacatctgcctcgttcccgaagttccc
tttacgcttgacgggctcttcaaggctctcgaaagccgttacgccagcggcaagactcac
gccgtgatcgccgtcgccgaaggcgccggacaggaacttttcaaaaaccaggaagaacgc
agggacgcaagcggtaacattctgaagaacgatatcggtgaattcctgacccacaagatc
aaggaacatttcgatagcgtcggcaaggaaatcaacatcaagtactttgacccgagctac
acggtgcgtagcatcccggcgaaaggcacggacgccattttctgcttccagctcgcagaa
aacgcagtacacgcaggcatggcaggcaagacggacatggtcgttggcagcatgaacaac
gtattctcgcacgtgcctatcgaatacgccgtgagcgaacgcaagaaaatcaaccccaat
ggccccctgtggcatgccgttctcggtatcacgcgccagcaggactatttctccggcaag
ggcaaacgcagcaagtaa

DBGET integrated database retrieval system