KEGG   Fibrobacter succinogenes: Fisuc_1322Help
Entry
Fisuc_1322        CDS       T01099                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fsu  Fibrobacter succinogenes
Pathway
fsu00010  Glycolysis / Gluconeogenesis
fsu00030  Pentose phosphate pathway
fsu00051  Fructose and mannose metabolism
fsu00052  Galactose metabolism
fsu00680  Methane metabolism
fsu01100  Metabolic pathways
fsu01110  Biosynthesis of secondary metabolites
fsu01120  Microbial metabolism in diverse environments
fsu01130  Biosynthesis of antibiotics
fsu01200  Carbon metabolism
fsu01230  Biosynthesis of amino acids
fsu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fisuc_1322
   00030 Pentose phosphate pathway
    Fisuc_1322
   00051 Fructose and mannose metabolism
    Fisuc_1322
   00052 Galactose metabolism
    Fisuc_1322
  Energy metabolism
   00680 Methane metabolism
    Fisuc_1322
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Fisuc_1322
Enzymes [BR:fsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Fisuc_1322
Protein phosphatases and associated proteins [BR:fsu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Fisuc_1322
Messenger RNA biogenesis [BR:fsu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Fisuc_1322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACX74921
JGI: Fisuc_1322
UniProt: C9RQT5
Position
1636923..1638260
Genome map
AA seq 445 aa AA seqDB search
MTQDDIIKNPLDYDLSIETVGKGTLKSPMNGVPFVSENDKVSLTTDVNLISEYLAKGIPV
PSLEVAGPRQTIFHDPAWTRAGIVTCGGLCPGLNNVIKGLVQVLWFDYGVRNIFGIPYGY
RGLNPNYGYSPIVLDPDVVDAIQEDGGTILGSSRGMQDPAIMVDTLMRLNINVLFCIGGD
GTLRGAHAIAEEVKKRKQPISIIGIPKTIDNDLNLIDRTFGFETAVLSATDVITSAHIEA
NGAFNGLGLVKLMGRDSGFIAAYASLATTVVNICLVPEVPFTLDGLFKALESRYASGKTH
AVIAVAEGAGQELFKNQEERRDASGNILKNDIGEFLTHKIKEHFDSVGKEINIKYFDPSY
TVRSIPAKGTDAIFCFQLAENAVHAGMAGKTDMVVGSMNNVFSHVPIEYAVSERKKINPN
GPLWHAVLGITRQQDYFSGKGKRSK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggacgatatcatcaagaatccgttggattatgatctttccattgaaaccgtt
ggcaagggcacgcttaagtccccgatgaacggcgttcctttcgtttcggaaaacgacaag
gtcagccttaccactgacgtcaatctcatctctgaatacttagcgaagggtatcccggta
ccttcactcgaagtggccggccctcgacagacaattttccacgaccccgcctggacacgt
gcaggcatcgtcacatgcggtggtctctgcccaggtcttaacaacgtgatcaagggcctt
gtacaagtgctctggttcgactacggcgtgaggaacatcttcggtatcccgtacggctac
cgtggcttgaacccgaattacggttactcccccatcgtgcttgacccggatgtggtcgat
gccattcaggaagacggcggtacgattctcggtagctcccgcggcatgcaggacccggcc
atcatggtcgatacgctcatgcgactcaacatcaacgtgttgttctgcatcggtggtgac
ggtacgctccgtggcgcacatgctattgccgaagaagtcaagaagcgtaaacagcccatc
tcgattatcggcatcccgaagacgatcgataacgacttgaacttgatcgacaggacgttc
ggttttgaaaccgccgtgctcagcgccacagacgtgattaccagcgcccacattgaagca
aacggtgcattcaatggtcttggcctagtgaagctcatgggtcgtgactccggctttatc
gccgcgtatgcatcgcttgcaacaacagttgtgaacatctgcctcgttcccgaagttccc
tttacgcttgacgggctcttcaaggctctcgaaagccgttacgccagcggcaagactcac
gccgtgatcgccgtcgccgaaggcgccggacaggaacttttcaaaaaccaggaagaacgc
agggacgcaagcggtaacattctgaagaacgatatcggtgaattcctgacccacaagatc
aaggaacatttcgatagcgtcggcaaggaaatcaacatcaagtactttgacccgagctac
acggtgcgtagcatcccggcgaaaggcacggacgccattttctgcttccagctcgcagaa
aacgcagtacacgcaggcatggcaggcaagacggacatggtcgttggcagcatgaacaac
gtattctcgcacgtgcctatcgaatacgccgtgagcgaacgcaagaaaatcaaccccaat
ggccccctgtggcatgccgttctcggtatcacgcgccagcaggactatttctccggcaag
ggcaaacgcagcaagtaa

DBGET integrated database retrieval system