KEGG   Fibrobacter succinogenes: Fisuc_1322Help
Entry
Fisuc_1322        CDS       T01099                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fsu  Fibrobacter succinogenes
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fisuc_1322
   01230 Biosynthesis of amino acids
    Fisuc_1322
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fisuc_1322
   00030 Pentose phosphate pathway
    Fisuc_1322
   00051 Fructose and mannose metabolism
    Fisuc_1322
   00052 Galactose metabolism
    Fisuc_1322
  Energy metabolism
   00680 Methane metabolism
    Fisuc_1322
Enzymes [BR:fsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Fisuc_1322
Protein phosphatases and associated proteins [BR:fsu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Fisuc_1322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1636923..1638260
Genome map
AA seq 445 aa AA seqDB search
MTQDDIIKNPLDYDLSIETVGKGTLKSPMNGVPFVSENDKVSLTTDVNLISEYLAKGIPV
PSLEVAGPRQTIFHDPAWTRAGIVTCGGLCPGLNNVIKGLVQVLWFDYGVRNIFGIPYGY
RGLNPNYGYSPIVLDPDVVDAIQEDGGTILGSSRGMQDPAIMVDTLMRLNINVLFCIGGD
GTLRGAHAIAEEVKKRKQPISIIGIPKTIDNDLNLIDRTFGFETAVLSATDVITSAHIEA
NGAFNGLGLVKLMGRDSGFIAAYASLATTVVNICLVPEVPFTLDGLFKALESRYASGKTH
AVIAVAEGAGQELFKNQEERRDASGNILKNDIGEFLTHKIKEHFDSVGKEINIKYFDPSY
TVRSIPAKGTDAIFCFQLAENAVHAGMAGKTDMVVGSMNNVFSHVPIEYAVSERKKINPN
GPLWHAVLGITRQQDYFSGKGKRSK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggacgatatcatcaagaatccgttggattatgatctttccattgaaaccgtt
ggcaagggcacgcttaagtccccgatgaacggcgttcctttcgtttcggaaaacgacaag
gtcagccttaccactgacgtcaatctcatctctgaatacttagcgaagggtatcccggta
ccttcactcgaagtggccggccctcgacagacaattttccacgaccccgcctggacacgt
gcaggcatcgtcacatgcggtggtctctgcccaggtcttaacaacgtgatcaagggcctt
gtacaagtgctctggttcgactacggcgtgaggaacatcttcggtatcccgtacggctac
cgtggcttgaacccgaattacggttactcccccatcgtgcttgacccggatgtggtcgat
gccattcaggaagacggcggtacgattctcggtagctcccgcggcatgcaggacccggcc
atcatggtcgatacgctcatgcgactcaacatcaacgtgttgttctgcatcggtggtgac
ggtacgctccgtggcgcacatgctattgccgaagaagtcaagaagcgtaaacagcccatc
tcgattatcggcatcccgaagacgatcgataacgacttgaacttgatcgacaggacgttc
ggttttgaaaccgccgtgctcagcgccacagacgtgattaccagcgcccacattgaagca
aacggtgcattcaatggtcttggcctagtgaagctcatgggtcgtgactccggctttatc
gccgcgtatgcatcgcttgcaacaacagttgtgaacatctgcctcgttcccgaagttccc
tttacgcttgacgggctcttcaaggctctcgaaagccgttacgccagcggcaagactcac
gccgtgatcgccgtcgccgaaggcgccggacaggaacttttcaaaaaccaggaagaacgc
agggacgcaagcggtaacattctgaagaacgatatcggtgaattcctgacccacaagatc
aaggaacatttcgatagcgtcggcaaggaaatcaacatcaagtactttgacccgagctac
acggtgcgtagcatcccggcgaaaggcacggacgccattttctgcttccagctcgcagaa
aacgcagtacacgcaggcatggcaggcaagacggacatggtcgttggcagcatgaacaac
gtattctcgcacgtgcctatcgaatacgccgtgagcgaacgcaagaaaatcaaccccaat
ggccccctgtggcatgccgttctcggtatcacgcgccagcaggactatttctccggcaag
ggcaaacgcagcaagtaa

DBGET integrated database retrieval system