KEGG   Fibrobacter succinogenes: Fisuc_1458Help
Entry
Fisuc_1458        CDS       T01099                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
fsu  Fibrobacter succinogenes
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Fisuc_1458
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fisuc_1458
  Lipid metabolism
   00071 Fatty acid degradation
    Fisuc_1458
  Amino acid metabolism
   00350 Tyrosine metabolism
    Fisuc_1458
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Fisuc_1458
   00626 Naphthalene degradation
    Fisuc_1458
Enzymes [BR:fsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Fisuc_1458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1768074..1769225)
Genome map
AA seq 383 aa AA seqDB search
MRFYVPTDIYVEKDCVKNHAKEMLAVGKRALIVTGHSSAKANGSLNDVTEVLNNGGVAYQ
IFDEVEENPSTDTVGKGAQIAKDFSADFIIGIGGGSAIDAAKAMAILLVNPNVNADELHK
APSHPLNHAPVVAVPTTCGTGSEATPVAIITNHKINLKKSIPHRIFPVLALVDGKYLASA
KKQLIVNTAVDALAHMVESILNVHSNMLNRMCPEYGLKLWGECKNALIASVAANNTVAQN
TSQKAAPIDASLYEKLMYTSTIAGMSIAMTSTAVPHGMSYDLTLSKGTPHGPAVGYFLAA
YVEICQKKVPTDVEKILSLLGLQSIEEFEEMLRKLIGTCTVTRELRNKFAAAMKVNRSKL
DLVPGGITPEEVEFIYDKSLIVG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcgattttacgtacctacggatatctacgttgaaaaggactgcgtgaagaaccacgcg
aaagaaatgctcgccgtcgggaagcgcgcgctcattgtcactggacacagctccgctaag
gctaacggctccctgaatgacgtgaccgaagttctgaacaatgggggagtcgcctaccag
atttttgatgaagttgaagaaaacccgtccaccgataccgtggggaagggtgctcaaatc
gcaaaggatttcagcgctgattttattatcggcattgggggaggttccgctatcgatgcc
gccaaagctatggcgattctcctcgtgaatccaaacgtgaacgcagatgaactgcacaaa
gcgccgagtcatccgcttaaccacgcacctgttgtcgccgtcccgaccacttgcggaaca
ggctccgaagcaacaccggtcgccattatcacaaaccacaaaatcaatttaaagaagagt
attccgcacaggattttcccggtgcttgcgctcgttgacggaaagtatctcgcctccgcc
aaaaagcagctgattgtaaacaccgctgttgacgcgcttgcgcacatggtcgaaagtatc
ttgaacgttcactcgaacatgctcaaccgcatgtgtcccgaatatggcctcaaactttgg
ggagagtgcaaaaacgcgctcattgcctcggtcgccgcgaacaataccgtcgcgcaaaat
acctcgcaaaaagccgcgccgattgatgcaagtttgtacgaaaaactgatgtacacctcc
acaatcgcaggcatgtccatcgccatgacaagcaccgccgtaccgcacggcatgagctac
gatctcacgctcagcaaaggcacgccgcacggtcccgccgtcgggtacttcctcgccgcc
tacgtcgaaatctgccaaaagaaagttccaaccgatgttgaaaaaatcctctcgctttta
ggattgcaaagcattgaagaatttgaagaaatgctccgcaagctcatcggcacatgcacc
gtcacccgcgaattgcgcaacaagttcgctgccgcgatgaaagtgaaccgttccaaactc
gacctcgttcccggcggcattacccccgaagaagtcgaattcatctacgataaatctctg
attgtagggtag

DBGET integrated database retrieval system