KEGG   Fibrobacter succinogenes: Fisuc_1512Help
Entry
Fisuc_1512        CDS       T01099                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fsu  Fibrobacter succinogenes
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Fisuc_1512
Enzymes [BR:fsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Fisuc_1512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1845247..1845816
Genome map
AA seq 189 aa AA seqDB search
MMDFKKMEDGFRMILEGMGEDPNREGLIDTPKRVAKMYAELMTGLSGEMKAEDILKTRFH
EKYDEMIIVPDIEFASMCEHHFLPFTGKAHVAYIPGDCVVGLSKIPRVVEFYARFPQIQE
RMTRQIAELIQKVLQPKGVAVVLEASHMCMTMRGVKKPGATMVTTQLLGRFKTDEKTRAE
FMSRIYAPR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgatggattttaagaaaatggaagacggcttccggatgattctggaaggcatgggcgaa
gacccgaaccgcgaaggtcttatcgatacgccgaagcgtgttgcaaagatgtacgccgaa
ctcatgacgggcctctcgggcgaaatgaaggccgaggacatcctcaagacgcgtttccac
gaaaagtacgacgaaatgatcatcgtgccggatatcgagttcgcgagcatgtgcgaacac
cattttctgccgtttacgggcaaggcccacgtggcctacatcccgggtgattgcgtggtc
ggtctttcgaaaatcccgcgcgttgtggaattttatgcccgcttcccgcagattcaggaa
cgcatgacgcgccagattgcagaacttatccaaaaagtgctccagccgaagggcgttgct
gtggttcttgaagcttctcacatgtgcatgacgatgcgcggtgtgaaaaagccgggtgca
accatggtgaccactcagcttttgggccgtttcaagacggacgaaaagacccgcgctgaa
ttcatgtcccgcatttacgctccaaggtaa

DBGET integrated database retrieval system