KEGG   Fibrobacter succinogenes: Fisuc_1751Help
Entry
Fisuc_1751        CDS       T01099                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
fsu  Fibrobacter succinogenes
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:fsu00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:fsu00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2140898..2142052)
Genome map
AA seq 384 aa AA seqDB search
MFYKKHAIASILGCVAALSLVACGDDSSSGPSPEESAIQKMSIREKVGQMFFVRPEALDT
TIHWNEYAELPNYKLEQVNKTMLAVNKNYPIGGMILYAHNIVDETQLGNFIAEIRELNGS
PLLAIDEEGGRVARIANNENFDVPKYESMAAIAESDDPEEAYKAAFTIGTYVKKYGFDID
YAPVADVNTNPDNIVIGPRAFSDDPETAAKFVVSYLNGLESAGVIGTLKHFPGHGDVSTD
THYGYASTDKTWDEMLKCEMIPFKAGIKAGAQMIMTAHIAAPKVSGDDLPATLSSVILQD
KLRGELGFDGVIVTDAMDMGAITKQFSNAEAAIKSIQAGVDVVLCSREFTQVFDAVVKAV
KKGEIKESRIDESVKRILKLKKSK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgttttacaaaaagcacgccattgcaagtatccttggatgtgtagcggcactttctctt
gtcgcctgcggtgatgacagttcgagcgggccttcgcctgaagaatccgccatccagaaa
atgtccatccgcgaaaaagtcgggcagatgttctttgtgcgcccggaagcattggataca
accatccactggaacgaatacgcggagctccccaattacaagctagagcaagtcaacaag
accatgctcgcagtcaacaagaactaccctatcggcggcatgattctttatgcgcacaac
attgtcgatgaaacccagcttggaaacttcatcgctgaaattagggaactgaacggttca
ccgctcctcgccattgacgaagaaggcggtcgcgtcgcgcgcattgccaacaacgaaaat
tttgatgtgcctaaatacgaaagcatggccgccatcgcagaaagtgacgacccggaagag
gcttacaaagccgcatttaccatcgggacttacgtcaagaaatacggtttcgacattgac
tacgctcctgttgcggacgtgaacacgaatccagacaacatcgttatcggtccgcgcgcg
ttctcggacgacccggaaaccgctgccaagtttgtagtgagctatttgaatggtcttgaa
tccgcaggcgtcatcggcacactcaagcatttcccagggcatggcgacgtgagcacagac
acgcattacggttatgcttcaacggacaaaacatgggacgaaatgcttaaatgcgaaatg
atcccgttcaaagcgggaatcaaggctggcgcccagatgattatgacagcgcacattgcc
gccccgaaagtatccggcgatgatttaccggcaacgttatcatcggttattttgcaggat
aagctccgcggcgagctcggttttgacggagttatcgtgaccgacgccatggacatgggc
gccatcaccaagcaattcagcaatgccgaagcggcgatcaagtccatccaggctggcgtc
gatgtggtgctttgttccagagaattcacgcaggtttttgatgccgttgtcaaggctgtc
aaaaaaggcgaaatcaaggaatcgcgcatcgacgaaagcgtcaagcgaatcttgaagcta
aagaaaagcaaataa

DBGET integrated database retrieval system