KEGG   Fibrobacter succinogenes: Fisuc_1788Help
Entry
Fisuc_1788        CDS       T01099                                 

Definition
family 2 glycoside hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
fsu  Fibrobacter succinogenes
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:fsu00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:fsu00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:fsu00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2196177..2199674
Genome map
AA seq 1165 aa AA seqDB search
MNFGSSLSLVLSAGLLSAVSLFAQPNDEWNGKPRIFGVNRLNPHVTSMPYTTVEEAVKGD
RHASEWYQTLSGEWRFYHVDKPSQRNNDFYKDNYDVSKWDKIKVPSSWQLLGYDHPIYTN
VIYPWSQNNRVSAPYAPTDFNPVGHYRRTFTVPETWDGKRIRLHFEGVESAYYVWVNGNY
VGYSEDTFTGHEFDINKYLRKGENNISVQVFRWCDGSWLEDQDFIRLSGIMRDVYIYAVP
QVHIQDFQIDATLTNNYKDGLLKTTAWIYNSTGKQSGDYTVELSLYDASGAEVIKPTSQK
VSGIGPNGAEKSVHFEIPYSSPKRWSAETPDLYTAVLTFKDADGKILQVESNKIGFRKIE
IKKDNGAPRLYVNGMPVKFHGVDRHELDPDNGRAVTYDRMEKDVILMKRFNINALRMSHY
PNNPVMYDLCDKYGIYVIDEANVESHGANNDLPKNSDDWRAPAVDRMNSMVQRDKNHPSI
ILWSLGNEAGNGNVFASERQRAHEIDSTRFVHYEGDWNNADVNSWMYFGPDAIQNYRDAN
KPIMLCEYEHAMGNSVGDLQEYMDAFYGNPRSFGGFIWDFIDQGLRHKGTPYFEFGGMWG
DWQNDDNFCANGLVFPDRKIQPEMWEVKYQYSQVRVKNIDAAKGKIQIESRYLYKNLGDF
LDAYWQIRENGKVIKEGKLNGTQMNIGPNEKKEVTIEMPKIETTVGAEYFLDIDFRLKKD
ELWAKAGYSIGHEQFGIDLGQLWSTEIDISTLPTYKVNKSNGLEIEGSDFKIKFDERNGT
LASYVLDGDTIIKNGGIPNFWRAPIDNDKGFNMERGHGEWRKASQKRNVTSEVKEVSQQE
TQVTFNFSFPDVGGTKMKMTYYVYGSGDIVVSYTLNPDGSKSYLPNVGTLFTVPGGYEKV
RWFGRGPDENYIGRNRGSFMGLYSTLADSMTIKYMEIGETGQRTDVKWATLTNEKTGKGL
MIVGNPRMEFSAQHYTPEQLTNVKLPWELKRDKDITLRVDLHQMGVGGINSWGAQPLDAY
LLKANREYSHTFRLAPIRKQLNDPTEYSLLGFKNFGWNKEIPPAKYGLDEINKIYEKQPE
KDITEGANPDTEGLIPVALPGKIRNLAVAEKNYNVFDAQGKKVGAFTTRGVEDLHAITAG
LVKNSGVYIVKAKNGGQAFRITVKK
NT seq 3498 nt NT seq  +upstreamnt  +downstreamnt
atgaactttggttctagtttgtctttggttttgtctgctggactattgtccgcagtatct
ttgtttgcccagcccaacgatgaatggaatggcaagccaagaatttttggtgtgaacagg
ttgaatccgcacgtgacttcgatgccatatacgacagtcgaagaagctgtgaagggcgac
cgtcacgcttcggaatggtaccagacgctttcgggcgaatggagattttaccatgtcgat
aagcctagccagcgtaacaatgatttctacaaggataattacgatgtgtccaagtgggat
aaaatcaaggttccgagttcttggcagcttttaggctacgatcatccgatttacacgaac
gttatttatccgtggtcccagaacaaccgcgtttctgcaccgtatgctccgacggatttt
aacccggtcggtcattatcgccgcacgttcacggttcccgaaacttgggatggcaagcgc
atccgtttgcactttgaaggtgttgaatccgcttactatgtatgggtgaacggcaattat
gtcggctacagtgaagatactttcacgggtcatgaattcgatatcaataagtacctccgc
aagggcgaaaacaacatctctgtgcaggtgttccgctggtgcgacggttcttggctcgaa
gaccaggactttatccgtctttccggtattatgcgcgatgtgtatatctacgctgtgccg
caggtccatattcaggacttccagattgatgctactcttacgaacaactacaaggatggt
ctcttaaagacgaccgcttggatttacaattctacgggcaagcagtctggtgattacacc
gtggaactttctttgtacgatgcttccggtgccgaagtgattaagccgacttcccagaag
gtttccggcattggtccgaatggtgccgaaaagagcgtccactttgaaattccgtattct
tctccgaagcgttggtctgctgaaacgccggacctctataccgcagtgctcacgttcaag
gatgctgacggcaagattctccaggttgaaagtaacaagattggcttccgcaagattgaa
atcaagaaagacaatggtgctccgcgtttgtacgtaaacggcatgcctgtgaagttccat
ggtgtggaccgtcacgaacttgatccggataacggccgtgctgtgacttacgatcgtatg
gaaaaagacgtgattctcatgaagcgtttcaatatcaatgcgctccgcatgtcccattac
ccgaacaacccggtgatgtatgatttgtgcgacaagtacggtatttacgtgattgatgaa
gcgaacgtcgaaagccacggtgccaacaacgatcttccgaagaatagcgatgattggcgc
gctccggctgtggaccgcatgaattccatggtgcaacgtgataaaaaccatccgtccatt
attctttggtctctcggtaacgaagccggtaacggtaacgtgttcgcctcggaacgtcag
cgtgctcatgaaatcgactctacgcgctttgtgcattacgaaggcgactggaacaatgcc
gatgtgaacagctggatgtactttggtccggatgcaattcaaaattatagggatgccaac
aagccgattatgttgtgcgaatacgaacacgctatgggtaactccgtgggtgatttgcag
gaatacatggatgccttctacggcaacccgcgcagcttcggtggcttcatttgggacttc
attgaccagggtctccgtcacaagggtactccgtacttcgaattcggcggcatgtggggc
gactggcagaacgacgacaacttctgcgcgaacggcctcgtgttcccggaccgtaaaatc
cagcccgaaatgtgggaagtcaagtatcagtacagccaggtgcgcgtcaagaatatcgat
gccgccaagggcaagattcagatcgaaagccgctacctttacaagaacctgggcgatttc
ctcgatgcctactggcagattcgcgaaaatggcaaggtcattaaggaaggcaagctgaac
ggtacccagatgaatatcggcccgaacgaaaagaaagaagtgactatcgaaatgccgaaa
atcgaaaccacggtcggcgccgaatacttcttggatattgatttccgcctgaagaaagat
gaactctgggctaaggccggctacagcatcggtcacgaacagttcggcatcgatttgggt
cagctctggtcgactgaaattgatatcagcaccttgccgacttacaaggtcaacaagtct
aacggtctcgaaatcgaaggttctgatttcaagataaagttcgacgagaggaacggtact
cttgcaagttacgtgctcgatggtgataccatcatcaagaacggcggtattccgaatttc
tggcgtgccccgattgacaatgacaagggcttcaacatggaacgcggccatggcgaatgg
cgcaaggcaagccagaagcgcaacgtgacctccgaagtcaaggaagtgtctcagcaagaa
acccaggtgaccttcaacttcagcttccccgatgtgggcggcaccaagatgaagatgact
tactacgtatatggtagtggcgatatcgtggtgagctacacgctcaatcccgatggctcc
aagagctacttgccgaacgtgggaacgctctttaccgtgccgggcggctacgaaaaggtc
cgctggtttggtcgcggccccgacgaaaactatattggccgtaaccgcggaagcttcatg
ggtctctattcaacgctcgccgattctatgacaatcaagtacatggaaattggcgaaacg
ggtcagcgtaccgatgtcaagtgggctacgctcacgaacgaaaagacgggcaagggcctc
atgattgtgggtaacccgcgcatggaattcagcgcccagcactacactccggaacagctc
actaatgtaaagctcccgtgggaactcaagcgcgacaaggacattacgctccgcgtagac
ttgcaccagatgggcgttggcggtatcaattcctggggtgcccagccgctcgatgcgtac
ctgctcaaggctaaccgcgaatattctcacaccttccgcctggctccgattcgtaagcag
ttgaacgacccgacggaatactcgctgcttggtttcaagaactttggctggaacaaggaa
attccgcctgctaagtacggcctggatgaaatcaataagatttacgaaaaacagccggaa
aaggacatcacggaaggcgcaaatccggatacggaagggcttattcctgttgcgctcccg
ggcaagattcgtaaccttgctgtcgctgaaaagaactacaatgtctttgatgcgcagggc
aagaaggttggtgcatttacgactcgcggtgtcgaagatctccacgctatcacggctgga
ctcgtcaagaactctggcgtgtatatcgtgaaggctaagaacggtggtcaagccttccgc
atcaccgtcaagaagtaa

DBGET integrated database retrieval system