KEGG   Fibrobacter succinogenes: Fisuc_1985Help
Entry
Fisuc_1985        CDS       T01099                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
fsu  Fibrobacter succinogenes
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Fisuc_1985
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Fisuc_1985
Enzymes [BR:fsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Fisuc_1985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2442524..2443792)
Genome map
AA seq 422 aa AA seqDB search
MRFEKAFVLVCFAAFSVFAQDYQIDRYIPESSSSEVSMCVMMSSSSVQQMTPAVSSSSTT
VQSSSSVAKSGKNPYNLPDELMPLWNSMSMRQKAGQMIMVFLTSPQFVIENELGGVLITG
KHLRSFDNYKERMDEIDSNLKIPLFTALDQEGGIVNRLASFSDNWRHTPSALEMRRMDTT
QIRTLAKKIGRALKDIRINMNLAPVLDPSKDHRGTNSFMEESRRSWGNDTTNAYKIRAFV
HGMRDNGVICVSKHFPGYDAWTNSDLQIAISASPKEKIEQNISFFRTLSKDIPVTMMSSV
HFLRISSRPAVFDANIVKMARKNSPDMVMLTDDLWGTSLRAWASGKTQIPPRKTYPDKDF
KRLVTAIIDAGNDILMISYTSKAKDMLNIMMELSDKSSKYKKRIEESAARILKLKYKMGL
LK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcgctttgaaaaagcttttgtcctagtctgctttgcagcattttccgtctttgcgcaa
gattatcaaattgaccggtatataccagagtcgagttcttccgaagtttcgatgtgcgtg
atgatgtcctcgtcaagcgtacagcaaatgacgcctgccgtgagcagttcgtccacaaca
gtacagtcttcgtcaagcgttgctaagtccggcaaaaatccgtacaacttgcccgatgaa
ctcatgcctttgtggaattccatgtccatgcgccaaaaagcgggccaaatgatcatggtg
ttcctcacctcgccgcaattcgtgatcgaaaacgagctcggcggcgttctcatcacaggc
aagcacctccgcagtttcgacaattacaaagaacgaatggacgaaattgacagcaacctg
aagattcctcttttcacagcacttgaccaagaaggcggcatcgtcaaccgtttggcatca
ttttccgacaattggcgacacacccccagcgcccttgaaatgcgccgtatggacaccacg
caaattcgcacacttgcaaaaaaaattggacgcgcactcaaggatatcagaattaacatg
aacttagctcccgttttggacccgtccaaggaccaccgcggcaccaattcgttcatggaa
gaaagccgacgctcgtggggcaacgacacgacaaacgcttacaaaataagagcattcgtc
cacggcatgcgcgataacggcgtcatctgcgtttcaaagcacttccccggttatgacgcc
tggacgaacagcgatttgcaaatcgccatcagcgcctcgcccaaggaaaaaatcgagcag
aacataagctttttcaggactctctccaaggacatacccgtcacgatgatgtcgagtgtc
cactttttgcgcatctctagccgtcccgccgtctttgacgccaacatcgtcaagatggcc
cgcaagaactccccagacatggtcatgctcaccgatgacctctggggcacctcgcttcgc
gcctgggccagcggcaaaacgcaaattcctcctcgcaagacctacccggacaaagacttc
aagcgcctcgtcaccgccatcattgacgcgggtaacgacatcctcatgatttcttacacg
tccaaagccaaggacatgctcaacatcatgatggaactttcagacaaaagctcaaaatac
aagaagcgcatcgaagaatccgctgcccgcatcttaaagctgaaatacaaaatgggtttg
ttgaagtag

DBGET integrated database retrieval system