KEGG   Fibrobacter succinogenes: Fisuc_2170Help
Entry
Fisuc_2170        CDS       T01099                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fsu  Fibrobacter succinogenes
Pathway
fsu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Fisuc_2170
Enzymes [BR:fsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Fisuc_2170
DNA repair and recombination proteins [BR:fsu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Fisuc_2170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 Viral_helicase1 AAA_11 Helicase_RecD PIF1 T2SSE UvrD_C ATPase_2 AAA_22 DUF2075 AAA_23 HHH_5 AAA_29 AAA_28 UvrD-helicase Bac_DNA_binding AAA AAA_18 AAA_14 NACHT DUF4291 PhoH AAA_16 NTPase_1 RsgA_GTPase AAA_12 TrwB_AAD_bind cobW
Motif
Other DBs
NCBI-ProteinID: ACX75756
JGI: Fisuc_2170
Position
complement(2680503..2682578)
Genome map
AA seq 691 aa AA seqDB search
MRLNDIESKKVVVITGTFPALQPGETISVEGDWGSHPKYGKQFQATSFEYLATEDNDILE
YLASGQFPGVGQKIAERIVEAFGDATADILDNNPDKFREVKIKGFPARKVEAFLARWQEA
RHSRETMLFLYKHEIVGSVAKRLWNKFGQATIERITQNPYMLCEEVWGIGFLKADEIAQK
VGFPKDSPERFQAALLYTLQEASVSDGHVFLPKNVLLERTFRNLRLMQDDEGAINTLLDE
FEKASECGRITREGDDCYFPPLYNAEQRIADNIKLRLRYNELSTEGFEDALAQWEREHKF
SFDPIQKRAIQMALSRKISIITGGPGTGKTTILKGILYLARQMEECVSLTAPTGRAAKRM
GECCGEKARTIHRLLEVDPISGKFHRDGDNKLQCNLLIVDEFSMVDTWLAASLLEATPLN
ARIVLVGDADQLPSVGAGNVLNDLLRCPKIPSTRLQHIFRQAGGNDIADKASKINQGISP
SPIEGTNFHFLPYESADEAKDIIARLVTRGIKEKIDINTQEMQLLTPMRKGPLGIYELNN
FLQDLLNPGKERIKIASGNWSTGDRVMQIRNNYDKNVFNGDVGIIYKIGKDTKKITVFYD
DKTVDYEPDEADELILAYACTIHKSQGSEYPAVIVVLDSSHSIMLQRNLIYTAITRAKGH
VWILSAPGAFYQAVRNNRSTRRYTRLTEKLD
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgaacgatattgaaagcaagaaagtcgttgtcatcacgggaacatttcccgct
ttgcaacctggcgaaacaatctctgtagaaggcgactggggttcgcatccgaaatacgga
aagcaattccaggcgacttcttttgaatacctcgccaccgaagacaacgatatccttgaa
tacttggcaagcggtcaatttccgggtgtggggcaaaagattgccgaacgcattgtggaa
gcttttggcgatgcaaccgccgacattctcgacaacaatccagacaagttccgcgaagta
aaaatcaaaggcttccccgcccgcaaggtggaagcttttttggcacgttggcaagaagca
cgtcacagccgcgaaacaatgctgttcttgtacaagcacgaaattgtcggcagtgtggca
aagcgcctttggaacaagttcgggcaagcgacaattgaacgcatcacacagaacccgtac
atgctctgcgaagaagtctggggcatcggattcttgaaggccgacgaaattgcgcaaaaa
gtcggattcccgaaagacagccccgagcgttttcaggccgcattgctttacacattgcaa
gaagcgtctgtgagcgatgggcacgtatttttgcccaagaacgtactcctggaacgcacg
ttccgcaacttgcgtttaatgcaggacgatgaaggcgccatcaacacgctcctcgacgaa
ttcgaaaaggcaagcgaatgcgggcgcatcacgcgcgaaggcgacgactgctattttccg
ccgctttacaatgccgagcagcgcatcgcagacaacatcaagctccgtttgcgatacaac
gagctttcaacggaaggcttcgaagacgccctggcgcagtgggaacgcgaacacaagttc
agctttgacccaatccaaaaacgcgctatccagatggcgctctcgcgaaagatatccatc
atcacaggtggaccaggtacaggcaagacgacaatccttaaagggattttgtacctcgcc
cgccaaatggaagaatgcgtaagcctcaccgccccaacggggcgcgccgccaagcgcatg
ggcgaatgctgtggcgagaaagcccgcacaatccaccgattgctcgaagtggacccgatt
tcgggcaagttccaccgcgatggcgacaacaagctccaatgcaatttgctcatcgtcgat
gaattcagtatggtcgatacgtggcttgccgcctcgctcctcgaagcgacgccactcaac
gcgcgaatcgttctcgtgggcgatgccgaccagctccccagcgtgggagctggcaatgtg
ctgaacgacttgttgcgttgccccaagattccgagcacccgccttcagcacattttccgc
caggccggcggaaacgacatcgccgacaaagcatctaaaatcaatcagggcattagcccc
tcgcccatcgaaggaacgaacttccactttttgccctacgagtcggccgatgaagctaaa
gacatcatcgcccgcctcgtcacgcgcggcatcaaggaaaaaatcgacatcaacacgcaa
gagatgcaactcctcacgccgatgcgcaaaggaccgctcggcatttacgaactgaacaac
ttcttgcaagacctcctgaaccccggcaaggaacgcattaaaattgccagcggcaactgg
agcacaggcgaccgcgtgatgcaaatccgcaacaactacgacaagaacgtgttcaacgga
gacgtcggcatcatctacaaaatcgggaaagacacgaaaaaaattaccgtcttttacgat
gacaagaccgtggattacgagcccgacgaagccgatgaacttatccttgcgtacgcctgc
accatccacaagagccagggtagcgaataccccgccgtcatcgtcgtgctagattcaagc
cacagcatcatgctgcagcggaacctcatctacaccgccatcacgcgtgcgaaaggtcat
gtgtggattttgtctgcaccgggagcgttctatcaagccgtgcgcaacaaccgcagcaca
agacgatacacacgcctcaccgagaagttggattag

DBGET integrated database retrieval system