KEGG   Fibrobacter succinogenes: Fisuc_2170Help
Entry
Fisuc_2170        CDS       T01099                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fsu  Fibrobacter succinogenes
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Fisuc_2170
Enzymes [BR:fsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Fisuc_2170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2680503..2682578)
Genome map
AA seq 691 aa AA seqDB search
MRLNDIESKKVVVITGTFPALQPGETISVEGDWGSHPKYGKQFQATSFEYLATEDNDILE
YLASGQFPGVGQKIAERIVEAFGDATADILDNNPDKFREVKIKGFPARKVEAFLARWQEA
RHSRETMLFLYKHEIVGSVAKRLWNKFGQATIERITQNPYMLCEEVWGIGFLKADEIAQK
VGFPKDSPERFQAALLYTLQEASVSDGHVFLPKNVLLERTFRNLRLMQDDEGAINTLLDE
FEKASECGRITREGDDCYFPPLYNAEQRIADNIKLRLRYNELSTEGFEDALAQWEREHKF
SFDPIQKRAIQMALSRKISIITGGPGTGKTTILKGILYLARQMEECVSLTAPTGRAAKRM
GECCGEKARTIHRLLEVDPISGKFHRDGDNKLQCNLLIVDEFSMVDTWLAASLLEATPLN
ARIVLVGDADQLPSVGAGNVLNDLLRCPKIPSTRLQHIFRQAGGNDIADKASKINQGISP
SPIEGTNFHFLPYESADEAKDIIARLVTRGIKEKIDINTQEMQLLTPMRKGPLGIYELNN
FLQDLLNPGKERIKIASGNWSTGDRVMQIRNNYDKNVFNGDVGIIYKIGKDTKKITVFYD
DKTVDYEPDEADELILAYACTIHKSQGSEYPAVIVVLDSSHSIMLQRNLIYTAITRAKGH
VWILSAPGAFYQAVRNNRSTRRYTRLTEKLD
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgaacgatattgaaagcaagaaagtcgttgtcatcacgggaacatttcccgct
ttgcaacctggcgaaacaatctctgtagaaggcgactggggttcgcatccgaaatacgga
aagcaattccaggcgacttcttttgaatacctcgccaccgaagacaacgatatccttgaa
tacttggcaagcggtcaatttccgggtgtggggcaaaagattgccgaacgcattgtggaa
gcttttggcgatgcaaccgccgacattctcgacaacaatccagacaagttccgcgaagta
aaaatcaaaggcttccccgcccgcaaggtggaagcttttttggcacgttggcaagaagca
cgtcacagccgcgaaacaatgctgttcttgtacaagcacgaaattgtcggcagtgtggca
aagcgcctttggaacaagttcgggcaagcgacaattgaacgcatcacacagaacccgtac
atgctctgcgaagaagtctggggcatcggattcttgaaggccgacgaaattgcgcaaaaa
gtcggattcccgaaagacagccccgagcgttttcaggccgcattgctttacacattgcaa
gaagcgtctgtgagcgatgggcacgtatttttgcccaagaacgtactcctggaacgcacg
ttccgcaacttgcgtttaatgcaggacgatgaaggcgccatcaacacgctcctcgacgaa
ttcgaaaaggcaagcgaatgcgggcgcatcacgcgcgaaggcgacgactgctattttccg
ccgctttacaatgccgagcagcgcatcgcagacaacatcaagctccgtttgcgatacaac
gagctttcaacggaaggcttcgaagacgccctggcgcagtgggaacgcgaacacaagttc
agctttgacccaatccaaaaacgcgctatccagatggcgctctcgcgaaagatatccatc
atcacaggtggaccaggtacaggcaagacgacaatccttaaagggattttgtacctcgcc
cgccaaatggaagaatgcgtaagcctcaccgccccaacggggcgcgccgccaagcgcatg
ggcgaatgctgtggcgagaaagcccgcacaatccaccgattgctcgaagtggacccgatt
tcgggcaagttccaccgcgatggcgacaacaagctccaatgcaatttgctcatcgtcgat
gaattcagtatggtcgatacgtggcttgccgcctcgctcctcgaagcgacgccactcaac
gcgcgaatcgttctcgtgggcgatgccgaccagctccccagcgtgggagctggcaatgtg
ctgaacgacttgttgcgttgccccaagattccgagcacccgccttcagcacattttccgc
caggccggcggaaacgacatcgccgacaaagcatctaaaatcaatcagggcattagcccc
tcgcccatcgaaggaacgaacttccactttttgccctacgagtcggccgatgaagctaaa
gacatcatcgcccgcctcgtcacgcgcggcatcaaggaaaaaatcgacatcaacacgcaa
gagatgcaactcctcacgccgatgcgcaaaggaccgctcggcatttacgaactgaacaac
ttcttgcaagacctcctgaaccccggcaaggaacgcattaaaattgccagcggcaactgg
agcacaggcgaccgcgtgatgcaaatccgcaacaactacgacaagaacgtgttcaacgga
gacgtcggcatcatctacaaaatcgggaaagacacgaaaaaaattaccgtcttttacgat
gacaagaccgtggattacgagcccgacgaagccgatgaacttatccttgcgtacgcctgc
accatccacaagagccagggtagcgaataccccgccgtcatcgtcgtgctagattcaagc
cacagcatcatgctgcagcggaacctcatctacaccgccatcacgcgtgcgaaaggtcat
gtgtggattttgtctgcaccgggagcgttctatcaagccgtgcgcaacaaccgcagcaca
agacgatacacacgcctcaccgagaagttggattag

DBGET integrated database retrieval system