KEGG   Fibrobacter succinogenes: Fisuc_2368Help
Entry
Fisuc_2368        CDS       T01099                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fsu  Fibrobacter succinogenes
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:fsu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:fsu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:fsu00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:fsu00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:fsu00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2915526..2916287)
Genome map
AA seq 253 aa AA seqDB search
MRQYIIAGNWKMNKTVSESVQLAKDIVEAVKDVKKTEVVIAPTYLAAAKVADVVKGTNVK
LAIQDIHWKDQGAYTGKVSIDMVKEIGAEYVIIGHSEQRQYFHETEETVNLKVKKTLEAG
LKPIICIGETLDQRNGGILKEVLGLQIKGAFKDVSAEDAAKCVLAYEPVWAIGTGVTATD
EQAEETQAYVRSVVKEIYGEAVAEGMRIQYGGSMKGANAAGLLAQKDIDGGLIGGAGLKA
NTFKEIIDAAEAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcagtatatcattgctggtaactggaagatgaacaagaccgttagcgaatccgtt
cagctcgctaaggatatcgtggaagccgtcaaggacgtgaagaagaccgaagtcgtgatc
gctccgacttacctcgctgctgctaaggttgcagacgtcgtgaagggcacgaacgtgaag
ctcgctatccaggacatccactggaaggaccagggcgcatacactggtaaggtttccatt
gacatggtcaaggaaatcggtgctgaatacgtgatcatcggtcactccgaacagcgtcag
tacttccacgaaacggaagaaaccgtgaacctcaaggtcaagaagactctcgaagctggc
ctcaagccgatcatctgcattggtgaaactctcgaccagcgcaacggcggcatcctcaag
gaagttctcggcctccagatcaagggcgctttcaaggacgtttctgctgaagacgctgct
aagtgcgttctcgcatacgaaccggtttgggcaatcggtactggcgttaccgctaccgac
gaacaggctgaagaaactcaggcttacgtccgctccgttgttaaggaaatctacggcgaa
gctgttgcagaaggcatgcgcattcagtacggtggctccatgaagggtgccaacgcagct
ggcctcctcgctcagaaggacatcgacggcggtctcattggtggtgcaggcctcaaggct
aacaccttcaaggaaatcatcgacgctgctgaagccaagtaa

DBGET integrated database retrieval system