KEGG   Fibrobacter succinogenes: Fisuc_2368Help
Entry
Fisuc_2368        CDS       T01099                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fsu  Fibrobacter succinogenes
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fisuc_2368
   01230 Biosynthesis of amino acids
    Fisuc_2368
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fisuc_2368
   00051 Fructose and mannose metabolism
    Fisuc_2368
   00562 Inositol phosphate metabolism
    Fisuc_2368
Enzymes [BR:fsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Fisuc_2368
Exosome [BR:fsu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Fisuc_2368
  Exosomal proteins of bladder cancer cells
   Fisuc_2368
  Exosomal proteins of melanoma cells
   Fisuc_2368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2915526..2916287)
Genome map
AA seq 253 aa AA seqDB search
MRQYIIAGNWKMNKTVSESVQLAKDIVEAVKDVKKTEVVIAPTYLAAAKVADVVKGTNVK
LAIQDIHWKDQGAYTGKVSIDMVKEIGAEYVIIGHSEQRQYFHETEETVNLKVKKTLEAG
LKPIICIGETLDQRNGGILKEVLGLQIKGAFKDVSAEDAAKCVLAYEPVWAIGTGVTATD
EQAEETQAYVRSVVKEIYGEAVAEGMRIQYGGSMKGANAAGLLAQKDIDGGLIGGAGLKA
NTFKEIIDAAEAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcagtatatcattgctggtaactggaagatgaacaagaccgttagcgaatccgtt
cagctcgctaaggatatcgtggaagccgtcaaggacgtgaagaagaccgaagtcgtgatc
gctccgacttacctcgctgctgctaaggttgcagacgtcgtgaagggcacgaacgtgaag
ctcgctatccaggacatccactggaaggaccagggcgcatacactggtaaggtttccatt
gacatggtcaaggaaatcggtgctgaatacgtgatcatcggtcactccgaacagcgtcag
tacttccacgaaacggaagaaaccgtgaacctcaaggtcaagaagactctcgaagctggc
ctcaagccgatcatctgcattggtgaaactctcgaccagcgcaacggcggcatcctcaag
gaagttctcggcctccagatcaagggcgctttcaaggacgtttctgctgaagacgctgct
aagtgcgttctcgcatacgaaccggtttgggcaatcggtactggcgttaccgctaccgac
gaacaggctgaagaaactcaggcttacgtccgctccgttgttaaggaaatctacggcgaa
gctgttgcagaaggcatgcgcattcagtacggtggctccatgaagggtgccaacgcagct
ggcctcctcgctcagaaggacatcgacggcggtctcattggtggtgcaggcctcaaggct
aacaccttcaaggaaatcatcgacgctgctgaagccaagtaa

DBGET integrated database retrieval system