KEGG   Fibrobacter succinogenes: Fisuc_2650Help
Entry
Fisuc_2650        CDS       T01099                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase (EC:3.5.99.7)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
fsu  Fibrobacter succinogenes
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Fisuc_2650
Enzymes [BR:fsu01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Fisuc_2650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3285559..3286503
Genome map
AA seq 314 aa AA seqDB search
MSTESVLQTPIVNLDNYAGNHLWIKRDDLIPFSFGGNKARKAFGFFREFDAGNYDCIVTY
GSSSSNHCRVVSNMARQRNIPCYIIAPEEASKPTFNSQLMDLFGAEFKVCPVKDVSKTID
EIILNLRAAGKKPYFIAGGGHGNIGTQAYVDCYNEICDFEKKNSVFFDYIFFASGTGTTQ
AGLVCGKMMNGDNRQIIGISIARKNPRGRNVVVDSVKEYLSAKSISFTDNQIEENVVFVD
DYTVDGYGCQNQLVQETIKNALFNYGIPMDSTYVAKAFAGMNDYLVLRKIKSKNVLFIHT
GGTPLFFDSLKDME
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagaaagcgtacttcagactccaatagttaaccttgataattatgcaggtaat
catctatggattaagcgagatgatctgatacctttttcttttggtggaaataaggctcgc
aaggcattcggcttttttagggagtttgatgccggaaattacgattgcattgtgacttat
ggcagtagcagctcaaatcactgtcgggttgtatcgaatatggcgaggcaaagaaacatt
ccctgctatattatagcacctgaagaggcttccaaaccgacattcaatagtcaattgatg
gatttattcggtgctgaatttaaggtttgtcctgtaaaagatgttagtaagacaattgat
gaaataatcctcaatctccgtgctgcgggcaaaaagccctactttattgctggtggtgga
catggcaatattggaacgcaggcgtatgtagactgctataacgaaatttgtgattttgaa
aagaagaactctgttttctttgattacatcttttttgcctcaggcacaggaacgactcag
gctggacttgtatgcgggaagatgatgaatggcgataatcgccaaattattggaatcagt
attgcccgaaaaaatccaagaggcagaaatgtcgttgttgattcagtcaaggaatatctg
tcagctaaatcaatctcgtttacagataatcaaattgaagaaaatgttgtttttgtcgat
gattataccgttgatggctatggttgtcaaaatcaattagttcaggaaacgataaaaaac
gccttgttcaattatgggattcctatggattctacatatgtggcaaaagcttttgccgga
atgaatgattatttagtgttacgcaaaattaaatcgaaaaatgtgctgtttatccataca
ggcggaacccctttgtttttcgacagtttgaaggatatggagtag

DBGET integrated database retrieval system