KEGG   Fibrobacter succinogenes: Fisuc_2777Help
Entry
Fisuc_2777        CDS       T01099                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
fsu  Fibrobacter succinogenes
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Fisuc_2777
Enzymes [BR:fsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Fisuc_2777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3428163..3429077)
Genome map
AA seq 304 aa AA seqDB search
MLRSLLESNRAISWKIGNDIIPASRMPLVMGIVNVTPDSFFDGGKHNTPEAAYEHAISLV
EQGAVILDIGGESSRPGSAPVSLQEELDRVCPVVEALAQTATISEDLDNPGFRKFYISVD
TVKAKVAEECMKLGAHIINDISACMMDPKMIETVASTKASVVLNHMRGNFGTMQQDFKPY
TNVVQEVQEELLAQVKKLLDAGVEKERICIDPGIGFGKTVQDNIDLMKSVDVMLKDGYPV
LIGTSRKSYIGKMPGLETSDRLIPTVTADIIAALGGASVIRVHDVREAKESLLYLEALKS
HDAV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgctccgctctctattagaatctaatcgtgcaatctcttggaaaattggaaacgacatc
attccagcttcgaggatgccgcttgtcatgggtatcgtgaatgttaccccggacagtttc
tttgatggaggcaagcataacacgcccgaagccgcttacgagcacgctatttcgttggtg
gaacaaggtgctgtgattctcgatatcggcggagaaagcagccgtccgggaagcgctccc
gtgagccttcaagaagaactcgaccgcgtatgccccgtcgtagaagcactcgcacagaca
gcaaccatttcggaagacctagacaatccgggattccgcaagttctacatctcggtcgat
acggtcaaggctaaagtcgccgaagaatgcatgaagctcggtgcgcacatcatcaacgac
atcagcgcctgcatgatggacccgaagatgatcgagaccgttgcaagcacaaaggcaagc
gtggtgctgaaccacatgcgcgggaacttcggaacgatgcagcaggacttcaagccgtac
acaaacgtggtgcaggaagttcaggaagaactcttggctcaggtgaagaagctccttgac
gccggtgtcgaaaaagaacgcatttgcattgatccgggtatcggttttgggaaaacggtt
caagacaacatagacttgatgaagtccgtggacgtgatgctcaaggacggctaccccgtt
ttgatcggcacgtcgagaaagtcctacatcggaaagatgcctggacttgaaacaagcgat
agacttatcccgaccgtgaccgcagacattatcgctgcccttggcggtgcaagcgttatc
cgcgttcacgatgttcgcgaagcaaaagaatcacttttatatttggaggctttgaagtcc
catgacgctgtttaa

DBGET integrated database retrieval system