KEGG   Fibrobacter succinogenes: Fisuc_3034Help
Entry
Fisuc_3034        CDS       T01099                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
fsu  Fibrobacter succinogenes
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Fisuc_3034
Enzymes [BR:fsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Fisuc_3034
Exosome [BR:fsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Fisuc_3034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3732767..3733732)
Genome map
AA seq 321 aa AA seqDB search
MIIRPRRLRRNEVIRNMVAETAVNPDALVYPMFVVEGTGVKEEIPSMPNQFRFSIDEILK
ELESCVALGIKSILLFGIPNHKDEMATSAYDKNGIVQRAVRAIKAKFPSLYVITDVCLCE
YMSHGHCGIIKDGDVDNDPTLELLAKTAVSQVAAGADMVAPSDMMDGHITALREALDNAG
FTNTPIMGYSAKFASAYYGPFRDAADSAPHFGNRKSYQMDVRNGREALHEVELDLEECAD
IVMVKPGLAFLDVLRQTAEISNVPVAVYNVSGEYSMVKAAAKMGWIDEKSIIRENMIAFK
RAGADIIITYHAKEILENKIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattattcgtcctcgtcgtttacgtagaaatgaagttatccgcaacatggttgcagaa
actgctgtaaatcccgatgccctcgtttacccgatgttcgtggttgaaggaacgggcgtc
aaagaagaaatcccgtccatgccgaaccagttccgtttctcgattgatgaaatcttgaag
gaacttgaaagctgtgtcgcgcttggcatcaagtccattttgctattcggcatcccgaat
cacaaggacgagatggcgacttcggcttatgataaaaacggcattgtgcagcgtgctgtg
cgtgctatcaaggcgaagttcccgagtttgtacgtgattacggacgtgtgcctttgcgaa
tacatgagccatggccattgcggcattatcaaggatggtgatgtggataatgacccaacg
cttgaacttttggcaaagaccgctgtttcgcaggtggctgccggtgccgacatggtggct
ccgagtgacatgatggatggccacatcacggctctccgcgaagctcttgacaatgcgggc
tttacaaatacgccgattatgggttatagcgcaaagttcgctagcgcttattacggtccg
ttccgcgatgccgctgattccgctccgcatttcggcaaccgcaagagttaccagatggac
gtgcgcaatggtcgcgaagcgctccatgaagtggaactcgatcttgaagaatgtgcagat
atcgtgatggtaaagcctggcctcgcattcctcgatgtgcttcgccagacggctgaaatc
agcaatgtgccggtcgctgtgtataacgtaagtggtgaatattcgatggtcaaggctgct
gcaaaaatgggctggattgatgaaaagtcgattatccgcgaaaacatgattgcgttcaag
cgcgccggtgctgatatcatcattacgtaccacgccaaggaaattttggaaaataaaatt
ctgtaa

DBGET integrated database retrieval system