KEGG   Fibrobacter succinogenes: Fisuc_3045Help
Entry
Fisuc_3045        CDS       T01099                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fsu  Fibrobacter succinogenes
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fisuc_3045
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fisuc_3045
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Fisuc_3045
Enzymes [BR:fsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Fisuc_3045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3745823..3747208
Genome map
AA seq 461 aa AA seqDB search
MRNSLKIDGQVKTYLHEDELPKAWYNVRADMKKKPAPLLNPGTGKPVTFEDLQPVFCDEL
IKQELDNDTAYIEIPEDIRTFYKMYRPSPLVRAYFLEQALGTPAHIYYKFEGNNTSGSHK
LNSAIAQAYYAKKQGLKGVTTETGAGQWGTALSMSSAFFGLDCQVYMVKVSYEQKPFRRE
VMRTYGASVTPSPSMTTDIGRKINAEFPGTTGSLGCAISEAVEAAVKQPGYRYVLGSVLN
QVLLHQSVIGLETKAALDKIGVKADLIIGCAGGGSNLGGLVSPFIGEKLRGEADYDILAV
EPASCPSFTRGKYAYDFCDTGKVCPLAKMYTLGSSFIPSANHAGGLRYHGMSSILSELYD
QGLMRATSVEQTKVFEAAKLFAQTEGILPAPESSHAIRATIDEALKCKESGQAKNIVFGL
TGTGYFDMVAYQKFNDGEMSDYIPTDEDIAKSLAQLPKVEG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagaaactcgctcaagatcgatggtcaggtcaagacttatctccacgaagatgaactt
ccgaaggcatggtacaacgtccgcgccgacatgaagaagaagcccgctccgcttctgaac
ccgggaaccggcaagccggtgactttcgaagacctgcagccggttttctgcgatgaactc
atcaagcaggaacttgataacgataccgcttacatcgaaattccggaagacatccgcacg
ttctacaagatgtaccgtccgtctccgctcgttcgcgcttacttcctcgaacaggctctc
ggcactccggctcacatctactacaagttcgaaggcaacaacacctcgggttctcacaag
ctcaactccgccatcgctcaggcctactacgctaagaagcagggcctcaagggcgtgacg
accgaaacgggtgcaggccagtggggtaccgccctttcgatgtccagtgccttcttcgga
ctggactgccaggtttacatggtgaaggtttcttatgaacagaagccgttccgccgcgaa
gtgatgcgcacctacggtgcatccgtcaccccgtccccgtccatgacgaccgacatcggc
cgcaagatcaacgccgaattcccgggcaccacgggtagccttggctgcgctatttccgaa
gctgtggaagccgctgtgaagcagccgggttaccgctatgttctcggttccgtgctaaac
caggtgctcctccaccagtccgtcatcggtctcgaaacgaaggctgcactcgacaagatc
ggcgtgaaggccgacctcatcatcggttgcgctggcggtggttctaacctcggtggtctc
gtgagcccgttcatcggcgaaaagctccgtggcgaagccgactacgatattctcgctgtg
gaaccggcaagctgcccgagcttcactcgcggtaagtacgcttacgacttctgcgacacc
ggtaaggtctgcccgctcgccaagatgtacacgctcggttctagcttcatcccgtctgca
aaccacgcgggtggcctccgctaccacggcatgagcagcattctctctgaactttacgat
cagggactcatgcgtgcaacgtctgtcgaacaaactaaggtcttcgaagccgcaaagctt
ttcgcccagaccgaaggtatcctcccggctccggaatccagccacgccatccgcgcaacg
atcgacgaagctctcaagtgcaaggaaagcggtcaggccaagaacatcgtattcggtctc
accggcacgggttacttcgacatggttgcttaccagaagttcaacgacggcgaaatgagc
gactacatcccgacggatgaagacattgccaagagcctcgcccagcttccgaaggtcgaa
ggctaa

DBGET integrated database retrieval system