KEGG   Fibrobacter succinogenes: Fisuc_3103Help
Entry
Fisuc_3103        CDS       T01099                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fsu  Fibrobacter succinogenes
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:fsu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3816361..3818577
Genome map
AA seq 738 aa AA seqDB search
MEWNDFTSLTAENMQAIWDFKTKDPFSILGIHPLETDRGIKTVIRTYQPQASFVRGESCD
GTEEFDFVKLGDTGFFEAILDLEYKPFFYKLIIKQGDGIEYTLVDPYAFLPVLSDFDRHL
IATGTHYELYRKLGANIIEHQGFKGVHFAVWAPNARAVSVVGNFNSWDGRRHQMRMLGAS
GIWEIFIPNLGENELYRFEIHGADGNLHVKVDPLAKLAEVRPATASITTHLDGYEWGDDL
YMKTHWATKVFGAPMNIYEVHAGSWRRDPANPDRFLNWDELSERLIPYLKEMGYTHVEFL
PLAEHPLDESWGYQVTGYYSPTSRYGTPDQFRHFVDLCHQNEIGVILDWVPAHFPKDAHA
LGRFDGTACYEHADPRQGEHPHWGTYIFNLGRNEVKNFLIANAMYWLKEFHCDGLRVDAV
ASMLYLDYGKGPGEWVPNKDGGNINYDTLEFLKHLNSIMGRLTPHAILIAEESTSFPSIT
RPPEQGGLGFHYKWNMGWMNDFLSYIQHEPIHRKYHHNQLTFSMVYAYSENFIQVFSHDE
VVHGKGSMLGKMPGDNWQKFANLRLTYAFQYAHPGKKLNFMGNEFGQFREWNEKRSLDWH
LVSWDSHGKLLEMMKVLNHIYKENAPLWEIDHYYTGFEWIWCDDADNSIVSFVRKDDHGN
MILCVFNFTPVVRNDYRLGAPARGAWKEIFNTDAAMFGGSNVGNLGEVWTQDVPWQNREW
SLNIKLPPLAAVYFKLER
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggaatggaacgatttcacgagcctgaccgcagaaaacatgcaggcaatttgggacttc
aagactaaagacccgttttcaattttaggtatccacccgctcgaaaccgatcgcgggatc
aagaccgtcatccgcacctaccagccgcaggccagctttgtccgcggtgaatcgtgcgac
ggcactgaagaatttgattttgtgaagcttggcgacacaggatttttcgaagccatcctc
gacttggaatacaagccgttcttttacaagctcatcatcaagcagggcgacggcatcgaa
tacacgctcgtcgatccgtatgcattcttgccggtcctcagcgactttgaccgccacctg
attgcaacaggcacgcactacgaactttaccgcaagctcggcgccaacatcatcgaacac
cagggattcaagggcgttcacttcgccgtctgggctccgaacgctcgtgccgtttctgtg
gtcggcaacttcaacagctgggacggccgccgtcaccagatgcgcatgctcggtgcctcg
ggcatttgggaaatcttcattccgaatcttggtgaaaacgaactctaccgctttgaaatt
cacggcgccgacgggaacctccatgtgaaggtggacccgcttgcaaagctcgccgaagtc
cgcccggcaacagcctccatcacaacacacctcgacggttacgaatggggcgatgatctt
tacatgaagacgcactgggccacaaaggtctttggcgctccgatgaacatttacgaagtc
cacgccggttcctggcgtcgcgacccggctaatccggaccgtttcctcaactgggacgag
ctctccgaacgcctcatcccgtacctcaaggaaatgggatacacgcacgtggaattcttg
ccgctcgccgaacacccgctcgacgaatcttggggctaccaggttaccggttactactcc
cccacgagccgctacggcacaccggaccaattccgccactttgtggacctttgccaccag
aacgaaatcggcgtgattttggactgggttccggcccacttcccgaaggatgcacacgct
ctcggacgtttcgacggcactgcctgctacgagcatgccgacccgcgtcagggcgaacac
ccgcactggggcacatacatctttaacctcggccgtaacgaagtcaagaacttcctcatt
gcaaacgcgatgtactggctcaaggaattccactgcgacggtctccgcgtcgatgctgta
gcctccatgctttacctcgactacggtaagggtccgggcgaatgggtgccaaacaaggac
ggcggcaacatcaactacgatacgctcgaattcctgaagcacttgaacagcatcatgggt
cgcctgaccccgcatgccatcctcatcgccgaagaatcaacaagcttcccgagcatcact
cgcccgccagagcagggcggtctcggcttccactacaagtggaacatgggctggatgaac
gacttcttgagctacatccagcacgaaccgatccaccgcaagtaccaccataaccagctt
acgttcagcatggtctacgcttattctgaaaacttcatacaagttttcagccatgacgaa
gtggtacacggcaagggttccatgctcggcaagatgcctggcgacaactggcagaagttt
gcaaacctccgcctcacctacgctttccagtacgcacacccgggcaagaagctcaacttc
atgggcaacgaattcggtcagttccgcgaatggaacgaaaagcgctcgcttgactggcac
ttggtcagctgggatagccacggcaagctccttgaaatgatgaaggttctgaaccacatc
tacaaggaaaatgctccgctatgggaaattgaccattactacaccggctttgaatggatc
tggtgcgacgacgccgacaattccatcgtaagcttcgtccgcaaggatgaccatggcaac
atgattctctgcgtgttcaacttcacgccggttgtccgtaacgattaccgtctgggcgct
cctgctcgcggtgcttggaaagaaattttcaacaccgatgcagccatgttcggcggctcc
aacgtcggcaatctcggtgaagtctggacgcaagatgttccatggcagaatcgtgaatgg
agcttgaacatcaagcttccgcctctcgcggcagtttacttcaaactcgagagatag

DBGET integrated database retrieval system