KEGG   Frankia symbiont: FsymDg_0069Help
Entry
FsymDg_0069       CDS       T01530                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
fsy  Frankia symbiont
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FsymDg_0069
Enzymes [BR:fsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     FsymDg_0069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(105840..106817)
Genome map
AA seq 325 aa AA seqDB search
MTGTHPARPISELRFLVAGAYVLDCLISTPRLPAWGDDLRADAMRTVPGGKALNQAVTLA
HLGAQVAAVGCVGTDVVGEAIRSALRAEGIDVSTMAAIPEAPTPVCVVYTRADGENAMVW
RVPDALNVTAGHLITAVKTSGPGDALLVTFESPDQAAGIITAASDQGIRVILNPAPLPSD
PAVIKAIPWEHVDMLVPNEAEARALLTGHSAAHGPAEHLADAVADALGVRTVCATLAEHG
CVLRIDGSTNAYPAPPADVIDVTGASDAFTAVLCAHLIAGTSPADAVHQAQAAAALTISR
PGAYEALPTATELHQQAMGLPNCSI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcacccacccagcgcgccctatcagcgagcttcggttcctcgtggccggcgcc
tacgtcctcgactgcctgatcagcacaccccgcctaccggcatggggcgacgacctacgc
gccgacgccatgcggaccgtcccgggcgggaaggcgctcaaccaggccgtcaccctcgcc
catctcggcgcccaggtcgccgccgtcggatgcgtcggaaccgatgtcgtgggcgaggcc
atcaggagtgcgctccgcgccgagggcatcgacgtctccaccatggcagccatccccgag
gcccccacaccggtctgtgtcgtctacacccgcgccgacggggagaacgccatggtctgg
cgtgtccccgacgcgctcaatgtcaccgccggccacctcatcaccgccgtaaaaaccagc
gggccgggagacgctctcctcgtcaccttcgagtcccccgaccaggccgccggaatcatc
accgcagccagcgatcagggcatacgtgtcatcctgaaccccgcgccgcttcccagcgat
ccagcggtcatcaaggctatcccgtgggaacacgtcgacatgctggttcccaacgaggcc
gaggcccgcgcccttcttaccgggcactcagccgcacacggccccgccgagcatctcgcc
gacgctgtagctgacgcacttggcgtgcggacagtctgtgccacccttgccgaacacgga
tgtgttctccggatcgacggctccaccaacgcctaccccgcaccacccgccgacgtcatc
gacgttaccggtgccagcgacgccttcaccgccgtactctgcgcccacctcatcgccggc
accagtccagccgacgcggtccaccaggcccaggcagccgcagccctcaccatcagccgt
cccggagcctacgaagcactccccaccgcgacggagctgcaccaacaagccatgggactg
ccgaattgctcgatttag

DBGET integrated database retrieval system