KEGG   Frankia symbiont: FsymDg_0187Help
Entry
FsymDg_0187       CDS       T01530                                 

Definition
(GenBank) fumarate reductase/succinate dehydrogenase flavoprotein domain protein
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
fsy  Frankia symbiont
Pathway
fsy00984  Steroid degradation
fsy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    FsymDg_0187
Enzymes [BR:fsy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     FsymDg_0187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_N GMC_oxred_C FAD_binding_2 DAO NAD_binding_8 Pyr_redox_2 FAD_binding_3 FAD_oxidored GIDA HI0933_like Thi4 OpcA_G6PD_assem Lycopene_cycl Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AEH07759
JGI: FsymDg_0187
UniProt: F8B2N9
Position
complement(236184..238151)
Genome map
AA seq 655 aa AA seqDB search
MSGGGTSGGVSGADGTAARSAASRGRFRRREGARAGSEKSEPAVAAGRWLAGRWLAGRWR
PPVLSRARSEESPRAGAEERAPAGADADVIVIGSGFGGSVAALRLAEKGYRVVVLEAGRR
FPPDALPRTSWNIRRYLWAPRLGCHGFQKFTMLGRVLVLSGAAVGGGSVVYANTLYRPLE
AFYTDPQWRHVTDWREELAPYYDQAERMLGVVPNPTVTYADEVYRAVAEEMGVGHTFKPS
NVGVFFGRDGRKEPGAEVGDPYFGGAGPTRTGCRECGECMTGCRWNAKNTLDHNYLYLAE
RTGAQVFPDTEATTVRPLPDGGYEVETVRTGSWVRHRRRTWRARQVVFAGGTLGTVRLLL
TMRDTRVLPALSARVGVLTRTNSESIIGATRLHPDERITRGVAITSSFYPAADTHVEPVR
YGRGSNALALLATLMTDGGRRIPRWLTFVGEALRHPFLFLYAPLPWRWSERTMISLVMQS
RDNSLTVVRRRGLFGGHGLTSRPGHGEPNPTWIPAGNDATRRIARRIGGFPGGTLTEIFD
IPLTAHILGGAAIGDSPSSGVVDPYQRVFGYDGLHVVDGAAISANLGVNPSLTIVAQAER
AMAMWPNSGEPDQRPPLGSPYRRVPPVRPVRPAVPEGAPAAYRVGLPLTVVRDRG
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtggcggtacgagcggcggcgtgtccggcgccgacggcacggcagcccggagc
gcggcgagccggggccggttccgccgccgcgagggggctcgcgccgggtcggagaagagc
gagcccgctgtggcggccgggcgctggctggccgggcgctggctggccgggcgctggcgg
ccgccggtcctttctcgcgccagatcggaagagtcgcctcgcgccggggcggaagagaga
gcacccgcgggcgcggacgccgatgtgatcgtgattggttccggattcggtggcagcgtc
gccgcgctccgactcgcggaaaaggggtaccgggtcgtcgttctggaggccggccgcagg
tttccccccgacgcgctgccccggaccagttggaacatccgccgttatctgtgggcaccc
cggctgggctgccacggattccagaagttcaccatgctcggccgtgtactcgtactgtcc
ggagccgctgtcggtgggggctcggtggtgtacgcgaacacgctctaccgtccgctggag
gcgttctacaccgacccgcagtggaggcatgtcaccgactggcgcgaggagttggcgcct
tactacgaccaggccgaacgcatgctcggggtggtgccgaacccgacggtcacctacgcc
gacgaggtgtaccgggcggtcgccgaggaaatgggtgtcgggcacaccttcaaaccgtcg
aacgtgggtgtcttcttcggccgggacggccggaaggaacccggtgcggaagtcggggat
ccctatttcgggggtgccgggccgacccgcaccggatgccgtgagtgcggcgagtgcatg
accggttgtcgttggaacgccaagaacacccttgaccacaactatctctatctggccgag
aggaccggcgcccaggtctttcccgacaccgaggccaccaccgtgcgcccgctgcccgac
ggcggctacgaggtggagacggtacgtaccggatcctgggttcgccaccgacggcggacg
tggcgggcgcgccaggtggtgttcgccggcgggacgctcggtaccgtgcggctcctgctc
acgatgcgggacaccagggtgctgccagcgctttcggcgcgggtcggcgtgctcacccgg
acgaactcggagtccatcatcggcgccaccaggctccatccggacgagcggatcaccagg
ggggtggcgataacgtcgtccttctatccggccgcggacacccatgtcgagcccgtccga
tacggccggggcagcaacgcgttggccctgttggccaccctcatgacggacggcggccgg
cggataccacgatggctcacattcgtcggcgaagcgttgcgtcatccgtttctgttcctc
tacgcgccgctgccgtggcgctggtcggaacgcaccatgatctcgctggtcatgcagtcc
cgggacaactcgctcacggttgtccgtcggcggggcctgttcggcgggcacgggctgacc
agcaggccggggcacggcgagccgaacccgacctggattccggccggtaacgacgcgacc
cggcggatcgcccggcgtatcggtggttttcccggcggcacactgacggagattttcgat
attccgttgacggcgcacatccttggtggagccgcgatcggggattctccgtccagcggg
gtcgtcgacccctatcagcgggtgttcggatatgacggtctgcatgtcgtcgacggggcg
gcgatatcggccaatctcggcgtcaacccgtcactgaccattgtcgcgcaggctgaacgc
gcgatggcgatgtggcccaacagcggcgaaccggaccagcgtccgccgctcgggtcaccg
taccggcgggtccctccggtacgtccggtacgtccggccgtaccggagggtgctccggcc
gcctaccgcgtcggcctgcccctgaccgtcgtccgcgaccgtggatga

DBGET integrated database retrieval system