KEGG   Frankia symbiont: FsymDg_0187Help
Entry
FsymDg_0187       CDS       T01530                                 

Definition
fumarate reductase/succinate dehydrogenase flavoprotein domain-containing protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
fsy  Frankia symbiont
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(236184..238151)
Genome map
AA seq 655 aa AA seqDB search
MSGGGTSGGVSGADGTAARSAASRGRFRRREGARAGSEKSEPAVAAGRWLAGRWLAGRWR
PPVLSRARSEESPRAGAEERAPAGADADVIVIGSGFGGSVAALRLAEKGYRVVVLEAGRR
FPPDALPRTSWNIRRYLWAPRLGCHGFQKFTMLGRVLVLSGAAVGGGSVVYANTLYRPLE
AFYTDPQWRHVTDWREELAPYYDQAERMLGVVPNPTVTYADEVYRAVAEEMGVGHTFKPS
NVGVFFGRDGRKEPGAEVGDPYFGGAGPTRTGCRECGECMTGCRWNAKNTLDHNYLYLAE
RTGAQVFPDTEATTVRPLPDGGYEVETVRTGSWVRHRRRTWRARQVVFAGGTLGTVRLLL
TMRDTRVLPALSARVGVLTRTNSESIIGATRLHPDERITRGVAITSSFYPAADTHVEPVR
YGRGSNALALLATLMTDGGRRIPRWLTFVGEALRHPFLFLYAPLPWRWSERTMISLVMQS
RDNSLTVVRRRGLFGGHGLTSRPGHGEPNPTWIPAGNDATRRIARRIGGFPGGTLTEIFD
IPLTAHILGGAAIGDSPSSGVVDPYQRVFGYDGLHVVDGAAISANLGVNPSLTIVAQAER
AMAMWPNSGEPDQRPPLGSPYRRVPPVRPVRPAVPEGAPAAYRVGLPLTVVRDRG
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtggcggtacgagcggcggcgtgtccggcgccgacggcacggcagcccggagc
gcggcgagccggggccggttccgccgccgcgagggggctcgcgccgggtcggagaagagc
gagcccgctgtggcggccgggcgctggctggccgggcgctggctggccgggcgctggcgg
ccgccggtcctttctcgcgccagatcggaagagtcgcctcgcgccggggcggaagagaga
gcacccgcgggcgcggacgccgatgtgatcgtgattggttccggattcggtggcagcgtc
gccgcgctccgactcgcggaaaaggggtaccgggtcgtcgttctggaggccggccgcagg
tttccccccgacgcgctgccccggaccagttggaacatccgccgttatctgtgggcaccc
cggctgggctgccacggattccagaagttcaccatgctcggccgtgtactcgtactgtcc
ggagccgctgtcggtgggggctcggtggtgtacgcgaacacgctctaccgtccgctggag
gcgttctacaccgacccgcagtggaggcatgtcaccgactggcgcgaggagttggcgcct
tactacgaccaggccgaacgcatgctcggggtggtgccgaacccgacggtcacctacgcc
gacgaggtgtaccgggcggtcgccgaggaaatgggtgtcgggcacaccttcaaaccgtcg
aacgtgggtgtcttcttcggccgggacggccggaaggaacccggtgcggaagtcggggat
ccctatttcgggggtgccgggccgacccgcaccggatgccgtgagtgcggcgagtgcatg
accggttgtcgttggaacgccaagaacacccttgaccacaactatctctatctggccgag
aggaccggcgcccaggtctttcccgacaccgaggccaccaccgtgcgcccgctgcccgac
ggcggctacgaggtggagacggtacgtaccggatcctgggttcgccaccgacggcggacg
tggcgggcgcgccaggtggtgttcgccggcgggacgctcggtaccgtgcggctcctgctc
acgatgcgggacaccagggtgctgccagcgctttcggcgcgggtcggcgtgctcacccgg
acgaactcggagtccatcatcggcgccaccaggctccatccggacgagcggatcaccagg
ggggtggcgataacgtcgtccttctatccggccgcggacacccatgtcgagcccgtccga
tacggccggggcagcaacgcgttggccctgttggccaccctcatgacggacggcggccgg
cggataccacgatggctcacattcgtcggcgaagcgttgcgtcatccgtttctgttcctc
tacgcgccgctgccgtggcgctggtcggaacgcaccatgatctcgctggtcatgcagtcc
cgggacaactcgctcacggttgtccgtcggcggggcctgttcggcgggcacgggctgacc
agcaggccggggcacggcgagccgaacccgacctggattccggccggtaacgacgcgacc
cggcggatcgcccggcgtatcggtggttttcccggcggcacactgacggagattttcgat
attccgttgacggcgcacatccttggtggagccgcgatcggggattctccgtccagcggg
gtcgtcgacccctatcagcgggtgttcggatatgacggtctgcatgtcgtcgacggggcg
gcgatatcggccaatctcggcgtcaacccgtcactgaccattgtcgcgcaggctgaacgc
gcgatggcgatgtggcccaacagcggcgaaccggaccagcgtccgccgctcgggtcaccg
taccggcgggtccctccggtacgtccggtacgtccggccgtaccggagggtgctccggcc
gcctaccgcgtcggcctgcccctgaccgtcgtccgcgaccgtggatga

DBGET integrated database retrieval system