KEGG   Frankia symbiont: FsymDg_0237Help
Entry
FsymDg_0237       CDS       T01530                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
fsy  Frankia symbiont
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fsy00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
295556..296575
Genome map
AA seq 339 aa AA seqDB search
MQASRGLLEPLGRTRVMGVVNVTPDSFSDGGAYPTAVDAVRAGLAMAAEGADIVDVGGES
TRPGAGRVDPAEELRRVLPVVTELAAAGVAVSVDTTRPAVAEAALAAGAAVINDVSGAAD
RDLLAVAAERAVPYVLMHTRGVSADMATRAVYGDVVSEVVAELRERLDAVFAAGIAPERV
IVDPGIGFAKESGHNWTLLAHLDAIAALGHPLLVGTSRKSFLGSLLADADERPRPAGERD
DATQATTALLAADGVWAVRVHAVRAAADAVRVVQAWREARERRAWPAGGGPAPAERTPAR
PDSAVSDPGRSNPGTSDPGVTDPGVSARGAFRLPPTSAV
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggccagccgtggtcttctggagccgctgggtcgtacccgcgtgatgggtgtggtc
aatgtgacaccggactcgttctccgacgggggcgcctatccgaccgcggtcgacgcggtg
cgggccggtctggcgatggctgccgagggcgccgacatcgtcgacgtcgggggcgagtcg
acccggccgggcgcggggcgggtcgatccggccgaggagctgcgccgggtgctgccggtg
gtgacggagctggccgcggcgggtgtcgcggtgagcgtcgacacgacccgtccggccgtc
gccgaggccgcgctggccgcgggcgccgcggtcatcaacgacgtgtcgggcgccgccgac
cgtgacctgctggcggtggccgccgagcgggcggtcccctacgttctgatgcacaccaga
ggtgtgagcgcggacatggccacccgcgcggtctacggtgatgtcgtgtccgaggtcgtc
gccgagctgcgtgagcgcctcgatgccgtgttcgccgccgggatcgcgcccgaacgggtg
atcgtcgacccggggatcggtttcgcgaaggagagcgggcacaactggacattgctggct
cacctcgacgccattgccgcgctggggcatccgctgctggtcggcacgtcacgcaagtcc
ttcctgggcagcctgctcgcggacgccgacgagcgtccccgcccggccggggagcgcgac
gacgcgacccaggcgacgaccgccctgctggcggccgacggggtgtgggcggtccgggtg
cacgcggtgcgggccgcggccgacgcggtgcgggtcgtccaggcatggcgggaggcccgc
gagcggcgggcctggccggctggcggcgggcccgcgccggcggagcggacacccgccagg
ccggattccgccgtgtcggacccggggaggtcgaatcctgggacgtcggatcctggcgtc
acggatcctggcgtgtcggcccgtggcgcgttccggctcccgcccacgagtgcggtatga

DBGET integrated database retrieval system