KEGG   Frankia symbiont: FsymDg_0239Help
Entry
FsymDg_0239       CDS       T01530                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
fsy  Frankia symbiont
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FsymDg_0239
Enzymes [BR:fsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     FsymDg_0239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
297183..297644
Genome map
AA seq 153 aa AA seqDB search
MLALGSNLGDRLAQLRAATRLLGSVAVSPVYETAPVGGPDQDDYLNAVVLVPAAPPRDLL
AAARSAERAAHRARTVRWGPRTLDVDVIACGDLVSDDPDILIPHPRAHLRAFVCVPWLDV
DPDAALPGHGRVEELVAALDTSGVRRTPWSLSG
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
gtgctggcgctgggctcgaacctcggcgaccgcctcgcccagctgcgtgccgccacccgc
ctgctggggtccgtggcggtgtcaccggtgtacgagaccgcgcccgtcggcgggcccgac
caggacgactacctcaacgcggtggtactggtcccggcggcgccgccgcgggacctgctc
gccgcggcccggtcggccgagcgggcggcccaccgggcacgaaccgtccgctggggcccg
cgcaccctggacgtcgacgtgatcgcctgtggcgatctggtcagcgacgacccggacatc
ctgatcccgcatccacgcgcccacctgcgcgcgttcgtctgcgtcccgtggctggacgtc
gacccggacgcggcgctgcccgggcacggccgggtcgaggaactggtggccgcgctggac
acctccggggtccgccggacgccgtggagtctgtccgggtga

DBGET integrated database retrieval system