KEGG   Frankia symbiont: FsymDg_0432Help
Entry
FsymDg_0432       CDS       T01530                                 

Definition
acireductone dioxygenase (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
fsy  Frankia symbiont
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    FsymDg_0432
Enzymes [BR:fsy01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     FsymDg_0432
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     FsymDg_0432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
508816..509400
Genome map
AA seq 194 aa AA seqDB search
MTHLTTWPADDPGRVLRDTDRPDEIAAALAPIGVRFDQWTIVDLPSDAGQDAVLTAYREQ
VDKVIADEGFILVDVVALHPTEAPDWPATATAARAKFLAEHTHADAEVRFFAAGAGVFYL
HIGDEVHAVLCEAGDLLSVPAGTTHWFDMGTSPSFTAVRFFHDADGWVGDFTGSDIASRF
PDFDVLYAVAVAAR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacctgacaacctggcccgccgacgacccgggccgcgtgctgcgcgacaccgat
cgaccggacgagatcgccgccgccctcgcgccgatcggtgtccggttcgaccagtggacg
atcgtggatctcccgtccgacgccggccaggacgcggtgctcaccgcctaccgggagcag
gtggacaaggtcatcgccgatgagggcttcatcctcgtggacgtggtggcgctgcatccg
accgaggcgcctgactggccggccacggccaccgccgcgcgggcgaagttcctcgccgag
cacacccacgcggacgccgaggtgcgcttcttcgccgccggcgccggcgtgttctacctg
cacatcggtgacgaggtccacgcggtgctctgcgaggccggcgacttgctgtcggtgccg
gctggtaccacgcactggttcgacatgggcaccagcccgtcgttcaccgcggtccgtttc
ttccacgacgccgacggctgggtcggtgacttcaccggcagcgacatcgcgtcccgtttc
cccgacttcgacgtgctgtacgccgtggccgtcgctgcccggtga

DBGET integrated database retrieval system