KEGG   Frankia symbiont: FsymDg_0454Help
Entry
FsymDg_0454       CDS       T01530                                 

Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
fsy  Frankia symbiont
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    FsymDg_0454
Enzymes [BR:fsy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     FsymDg_0454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(531110..532834)
Genome map
AA seq 574 aa AA seqDB search
MGGNEHADVVVVGSGFGGAVTAYRFAEAGHRVVLLERGKAYPPGSFARSPTEIAANFWDP
SQGRHGLFDVWSFADFEAVVSSGLGGGSLIYANVLLRKDEKWFVRDAPAGEGYENWPISR
ADLEPHYAAVEKTIGVQRFPKGQPRYQASRRTELLEQAGERLGYTAEQPPLAVTFGVGGD
APVPGAPIGEPAYGNIHGRPRITCVLCGECDLGCNYGSKNTLDHTYLSAAVHHGANVRVH
HEARSITPRDGGGYTVGYVVHTPGDVVATSALPQRTITCDRLVLAAGTLGTTYLLLRNRA
ALPGISRMLGRRFSGNGDLLGFVSGVPGPALGSAHAPVITTAVRVPDAVDSHGGHAGGHT
GGRGGPGADRGCYIEDAGYPGFAEWLVEAANLDNEASRIVRTVYELIRSRLTGGPSRQIG
ALVGRLLGPGEASAGAMPLLGMGRDIPTGKISVRDDYLQIENYPADSQPYFERLDRLMED
LAEEMGGKYHRNPLTLLSRVITVHPLGGASMGTDITTGVIDEWGEVFNHPGLYVADGAAL
PGPVGANPSLTIAAFADRLAEHAVDAGPVLETQP
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgggaacgaacacgcggacgtcgtggttgtcggttcgggattcggtggggcggtg
accgcctaccgtttcgccgaggcaggccacagggttgtcctgcttgagcgggggaaggcg
tatccaccggggtcgttcgcccgctccccgaccgagatcgcggcgaacttctgggatccg
agccagggtcggcacggccttttcgacgtctggtccttcgccgacttcgaggcggtcgtc
tccagcgggctgggtggcggctcgctcatctacgccaacgtcctgctccgcaaggacgag
aagtggttcgtccgcgacgcgcccgccggcgagggctacgagaactggccgatcagccgg
gccgacctggaaccgcactacgcggccgtcgaaaagacgataggtgtgcagcgcttcccc
aaggggcagccgcgctatcaggcctcccgccggaccgagctgctggagcaggccggtgaa
cggctcggatataccgccgagcagccgccgttggcggtcacgttcggtgttggcggcgac
gcgccggtaccgggggcgcccatcggtgagccggcctacggcaacatccacggtcggccg
cggatcacctgtgtgctgtgcggcgagtgcgacctcggctgcaactacggcagcaagaac
accctggaccacacctatctttcggccgcggtacaccacggcgcgaacgtgcgcgtccac
cacgaggcccgttcgatcaccccacgggacggcggcgggtacaccgtcggatacgtggta
cacacccccggcgatgtcgtcgccacctccgcgctcccccagcggacgatcacctgtgat
cgtctcgtccttgccgccggcacgctcggcaccacctacctgctgcttcgcaaccgcgcc
gcattacccggcatctcccggatgctcgggcgacgcttcagcggcaacggcgacctgctc
ggcttcgtcagcggggtgcccggcccggccctgggcagcgcgcacgccccggtcatcacg
accgccgtccgcgtccccgacgccgtcgacagccacggcggccatgccggcggccacacc
ggcggtcgcggcggccccggcgccgaccgcggctgctacatcgaggacgccggctacccc
ggtttcgccgaatggctcgtcgaggcggccaacctggacaacgaggcgtcccggatcgtc
cgcaccgtctacgagctgatccgttcccgtctcaccggcggtccgtcccgccagatcggc
gcgctggtcggccggctgctcggcccgggagaggcgtccgccggcgcgatgcccctgctg
ggcatggggcgcgacattcccaccggaaaaatttcggtacgcgacgactatctgcagatc
gagaactatccggcggacagccagccgtactttgagcgcctggacaggctcatggaggac
ctggccgaggaaatgggcggcaaataccaccggaatccgctgaccctgctgtcccgggtc
atcaccgtgcatcctctcggcggcgcctccatgggcaccgacatcaccaccggcgtcatc
gacgaatggggcgaggtgttcaaccaccccggcctgtacgtcgccgacggcgccgccctg
cccggaccggtcggggcgaacccgtcgctgaccatcgccgccttcgccgaccggctcgcc
gaacatgccgtggatgccggccccgtcctggagacacagccatga

DBGET integrated database retrieval system