KEGG   Frankia symbiont: FsymDg_0588Help
Entry
FsymDg_0588       CDS       T01530                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
fsy  Frankia symbiont
Pathway
fsy00010  Glycolysis / Gluconeogenesis
fsy00071  Fatty acid degradation
fsy00350  Tyrosine metabolism
fsy00625  Chloroalkane and chloroalkene degradation
fsy00626  Naphthalene degradation
fsy01100  Metabolic pathways
fsy01110  Biosynthesis of secondary metabolites
fsy01120  Microbial metabolism in diverse environments
fsy01130  Biosynthesis of antibiotics
fsy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FsymDg_0588
  Lipid metabolism
   00071 Fatty acid degradation
    FsymDg_0588
  Amino acid metabolism
   00350 Tyrosine metabolism
    FsymDg_0588
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FsymDg_0588
   00626 Naphthalene degradation
    FsymDg_0588
Enzymes [BR:fsy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     FsymDg_0588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AEH08118
JGI: FsymDg_0588
UniProt: F8AUS4
Position
679349..680365
Genome map
AA seq 338 aa AA seqDB search
MTPTMIGWQVATPAPAAARPLRRAVVPVPEPAVGQVRLRVAACGVCRTDLHLAEGDLPPR
RPGTIPGHEVVGYVDALGDDVDGAAIGDRLGIAWLRETDGACGYCRRGAENLCPASRYTG
WDADGGYAEYAVVRADYAYQLPAGYSDGELAPLLCAGIVGFRALRRAELPPGGRLGIYGF
GASAHLAAQVALAEGARVHVMTRSEAARRLALSLGASSASGAYEAPPEPLDAAVLFAPVG
DLVPVALRALDRGGTLSIAGIHLSDVPVLNYQQHLFQERSVRSTTANTRADGHEFLEIAG
RHRLAVTITPYPLDRADDALVDLAADRVNGAAVLFPSD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgacgatgatcggttggcaggtcgccacaccggctccggccgcggcccggccg
ctgcgccgggcggtcgtcccggtacccgaaccggccgtcggccaggttcggctgcgggtc
gcggcctgcggtgtctgccgcaccgacctgcatctcgccgaaggcgacctgccgccacgc
cggcccggcaccatccccgggcacgaggtcgtcggctacgtcgacgcgctcggtgacgac
gtcgacggggccgccatcggtgaccgcctcggcatcgcctggctgcgggagaccgacggc
gcttgcggctactgccggcgcggcgcggagaacctgtgcccggcgtcccgctacaccggc
tgggacgccgacggcggctacgccgagtacgccgtcgtccgcgccgactacgcctaccag
ctgccggccggctactccgacggggagctggcgccgttgctgtgcgcgggcattgtcggc
ttccgagcgctgcgccgggcggagctgccgcccggcggccggctggggatctacggtttc
ggcgcgtcggcccacctggccgcgcaggtggcgctggcggagggagcgcgggtgcacgtc
atgacccggtccgaggcggcccgccggctcgcgctctcgctcggcgcgtcgtcggcgtcc
ggtgcctatgaggcaccgccggagccgctggacgccgcggtcctcttcgccccggtcggc
gatctggtgccggtcgcgctgcgtgccctcgaccggggcgggacgctgtcgatcgccggc
atccacctctccgacgtgccggtactgaactaccaacagcatctgttccaggaacgctcc
gtacgcagcacgaccgcgaacacccgagcggacggccacgagttcctggagatcgccggc
cggcaccgcctggcggtcacgatcacgccttatccgctcgaccgcgctgacgacgcgctc
gtcgacctggctgcggaccgggtcaacggcgccgcggtgctgttcccgtccgactga

DBGET integrated database retrieval system