KEGG   Frankia symbiont: FsymDg_0588Help
Entry
FsymDg_0588       CDS       T01530                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
fsy  Frankia symbiont
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    FsymDg_0588
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FsymDg_0588
  Lipid metabolism
   00071 Fatty acid degradation
    FsymDg_0588
  Amino acid metabolism
   00350 Tyrosine metabolism
    FsymDg_0588
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FsymDg_0588
   00626 Naphthalene degradation
    FsymDg_0588
Enzymes [BR:fsy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     FsymDg_0588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
679349..680365
Genome map
AA seq 338 aa AA seqDB search
MTPTMIGWQVATPAPAAARPLRRAVVPVPEPAVGQVRLRVAACGVCRTDLHLAEGDLPPR
RPGTIPGHEVVGYVDALGDDVDGAAIGDRLGIAWLRETDGACGYCRRGAENLCPASRYTG
WDADGGYAEYAVVRADYAYQLPAGYSDGELAPLLCAGIVGFRALRRAELPPGGRLGIYGF
GASAHLAAQVALAEGARVHVMTRSEAARRLALSLGASSASGAYEAPPEPLDAAVLFAPVG
DLVPVALRALDRGGTLSIAGIHLSDVPVLNYQQHLFQERSVRSTTANTRADGHEFLEIAG
RHRLAVTITPYPLDRADDALVDLAADRVNGAAVLFPSD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgacgatgatcggttggcaggtcgccacaccggctccggccgcggcccggccg
ctgcgccgggcggtcgtcccggtacccgaaccggccgtcggccaggttcggctgcgggtc
gcggcctgcggtgtctgccgcaccgacctgcatctcgccgaaggcgacctgccgccacgc
cggcccggcaccatccccgggcacgaggtcgtcggctacgtcgacgcgctcggtgacgac
gtcgacggggccgccatcggtgaccgcctcggcatcgcctggctgcgggagaccgacggc
gcttgcggctactgccggcgcggcgcggagaacctgtgcccggcgtcccgctacaccggc
tgggacgccgacggcggctacgccgagtacgccgtcgtccgcgccgactacgcctaccag
ctgccggccggctactccgacggggagctggcgccgttgctgtgcgcgggcattgtcggc
ttccgagcgctgcgccgggcggagctgccgcccggcggccggctggggatctacggtttc
ggcgcgtcggcccacctggccgcgcaggtggcgctggcggagggagcgcgggtgcacgtc
atgacccggtccgaggcggcccgccggctcgcgctctcgctcggcgcgtcgtcggcgtcc
ggtgcctatgaggcaccgccggagccgctggacgccgcggtcctcttcgccccggtcggc
gatctggtgccggtcgcgctgcgtgccctcgaccggggcgggacgctgtcgatcgccggc
atccacctctccgacgtgccggtactgaactaccaacagcatctgttccaggaacgctcc
gtacgcagcacgaccgcgaacacccgagcggacggccacgagttcctggagatcgccggc
cggcaccgcctggcggtcacgatcacgccttatccgctcgaccgcgctgacgacgcgctc
gtcgacctggctgcggaccgggtcaacggcgccgcggtgctgttcccgtccgactga

DBGET integrated database retrieval system