KEGG   Frankia symbiont: FsymDg_0591Help
Entry
FsymDg_0591       CDS       T01530                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
fsy  Frankia symbiont
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FsymDg_0591
DNA repair and recombination proteins [BR:fsy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      FsymDg_0591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(682582..683184)
Genome map
AA seq 200 aa AA seqDB search
MTMYEGIVQDLIDELGRLPGIGPKSAQRIAFHLLSADPVDVRRLAATLNEIKDKVRFCRT
CFNVAQAELCRICADHRRDPAQICVVEEPKDVVAVERTREFRGRYHVLGGAINPIGGVGP
DDLHIRELIARLADGTVTELILATDPNTEGEVTASYLARQIAPMGLKVTRLASGLPMGGD
LEWADEVTLGRAFEGRRVVA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatgtacgaggggatcgtccaggatctgatcgacgaactcggccggctgcccggc
atcggccctaaaagcgcgcaacggatcgccttccacctgctttccgccgacccggtggac
gtgcggcggctggcggccacgctgaacgagatcaaggacaaggtccgcttctgtcggacg
tgcttcaacgtcgcgcaggcggaactgtgccggatctgcgccgaccaccgtcgcgatccg
gcgcagatctgtgtcgtcgaagaaccgaaggacgtcgtcgccgtcgaacggacccgggag
ttccgtgggcgctaccacgttctcggcggggcgatcaatccgatcggcggagtcggcccc
gacgatctgcacatccgggagctgatcgcccgtcttgccgacggaacggtgaccgaactg
attctcgcgaccgatccgaacaccgagggtgaggtcaccgcctcctatctggcccggcag
atcgctcccatgggtctgaaggtcacccggctggccagcggcctgcccatgggcggagac
ctggaatgggcggacgaggtgacccttggccgcgcctttgaaggccgccgcgtcgtcgcc
tag

DBGET integrated database retrieval system