KEGG   Frankia symbiont: FsymDg_0673Help
Entry
FsymDg_0673       CDS       T01530                                 

Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fsy  Frankia symbiont
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FsymDg_0673
Enzymes [BR:fsy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     FsymDg_0673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(774225..774899)
Genome map
AA seq 224 aa AA seqDB search
MDTVDAATQNVNAGTVPASDVARQRRGPDLGPQAVRPFDHERVARAVRELLIGIGEDPDR
EGLRKTPERVARAYREAVEGLGRDPSEVLTTVFDEGHEEMVLVRDIDFTSLCEHHLVAFA
GKAHVAYIPNESGQITGLSKLARLVDLYSRRPQVQERLTTQIADALEQALSPRGVMVVVE
AEHLCMSMRGVRKPGARTMTSAVRGQFLSTATRNEGMSLILSHR
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtggacaccgtggacgcggccacgcagaacgtgaacgccggtacggtccccgcctcggac
gtcgcccgccagcggcggggaccggatctcgggccgcaggccgtccggccgttcgaccat
gagcgggtcgcccgcgccgtccgggagctgctgatcggtatcggcgaggacccggacagg
gaggggctgcgcaagaccccggaacgggtcgcccgtgcctaccgggaggcggtcgaaggc
ctcgggcgggacccctccgaggtgctgaccaccgttttcgacgaaggccacgaagagatg
gtgctggttcgcgacatcgacttcacgtcgctgtgcgagcaccatctggtcgcgttcgca
ggcaaggcgcatgtggcctacatcccgaacgaaagcggccagatcaccgggctgtccaag
ctcgcccggctcgtcgacctgtactcgcgacgccctcaggtgcaggaacggctgacgacc
cagatcgccgacgcgctggaacaggccctctcccccagaggggtcatggtcgtggtcgag
gccgagcatctgtgcatgtccatgcgcggggttcgcaagccgggcgcccgcacgatgacg
tcagcggtgcgcggccagttcctgagcaccgcgacccgcaacgagggtatgtcgctcatc
ctcagccaccgctga

DBGET integrated database retrieval system