KEGG   Frankia symbiont: FsymDg_0772Help
Entry
FsymDg_0772       CDS       T01530                                 

Definition
putative magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
fsy  Frankia symbiont
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FsymDg_0772
Enzymes [BR:fsy01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     FsymDg_0772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(910998..912455)
Genome map
AA seq 485 aa AA seqDB search
MLDLSGSPAQSPGPTSPSPGPTTLGLLRGSGHRYRSVRAELRENTLARMASGEIRFPGIV
GFDDTVLPQVERALLAGHDIVFLGERGQGKTRLIRTLVGLLDEWTPVIVGCEINDHPYAP
VCTRCRLLFTELGDDTPVAWKHRSERFGEKLATPDTSVGDLIGDVDPVKVAQGRTLGDPE
TVHYGLIPRTNRGIFSVNELPDLAERIQVSLLNVLEERDIQVRGYILRLPLDLFLIASAN
PEDYTNRGRIITPLKDRFGAEVRTHYPLRLDDELALIRQEAVLDWKGSPLGAPAVPEHLL
EVVARFTRLVRDAPQVDRRSGVSARLSVAAAETVAASAVRRAALTGEDVPTARVVDLAAI
VPAVRGKIEFDQLEEGREDEILAHLLRRAVAETFRARLAGTDLTGLQRRFETEGPVETGD
LVPAAELLRRVGPVSGLAAILAKLDVDGAEAPGLAAAGLELAMEGLHLNRRLAKEELPGR
TVYGT
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgatctgtcagggtccccggcacagtcccccggaccgacatcaccgtccccagga
ccaacgacgctgggcctcctgcgcggctcaggacaccggtaccgatccgtacgcgcggaa
ctgcgcgagaacacccttgcccgaatggccagcggtgagatccggttccccggcatcgtc
ggtttcgacgacaccgtgctcccccaggtggaacgggccctgctggccgggcacgacatc
gtcttcctcggcgagcgggggcagggcaagactcgcctgatccgcaccctggtcggcctg
ctggacgagtggacgccggtgatcgtcggctgcgagatcaacgaccatccctacgcaccg
gtgtgcacccggtgccggctgctgttcaccgagctcggcgacgacacgccggtcgcctgg
aagcaccggtcggaacggttcggcgagaagctcgccacgccggacacgagcgtcggcgac
ctgatcggcgacgtcgacccggtgaaggtcgcccagggccgcaccctcggcgacccggag
accgtccactacggcctgatccctcgcaccaaccggggcatcttcagcgtcaacgagctg
cccgacctcgccgagcgcatccaggtctccctgctcaacgtgctcgaggagcgtgacatc
caggtccgcggctacatcctgcggctgccgctggacctgtttctgatcgcgtcggcgaac
cccgaggactacaccaaccgcggccggatcatcacgccgctcaaggaccgtttcggcgcc
gaggtccgcacccactacccgctgcggctcgacgacgagctggcgttgatccggcaggag
gcggtgctggactggaagggctccccgctgggcgcccccgccgtccccgagcacctgctg
gaggtggtggcccgcttcacccggctggtccgcgacgcgccccaggtcgaccggcgctcc
ggtgtgtcggcccggctgtcggtggccgcggcggaaaccgtggccgcctcggccgtccgt
cgcgcggccctgaccggcgaggacgtccccaccgcccgggtcgtcgacctcgccgcgatc
gtaccggcggtacgcgggaagatcgagttcgaccagctcgaggagggacgggaggatgag
atcctcgcgcacctgctgcgccgggccgtcgccgagaccttccgcgcccggctcgccggc
accgacctgaccggcctgcaacggcggttcgagacggaggggccggtcgagaccggtgac
ctcgttcccgccgcggagctgctgcggcgggtcggcccggtctcggggctcgccgcgatc
ctggcgaagctggacgtcgacggcgccgaggcgccagggctcgccgcggccgggctggaa
ctggccatggagggcctgcacctcaaccggcggctggccaaggaggagctgccgggccgc
acggtgtacggcacatga

DBGET integrated database retrieval system