KEGG   Frankia symbiont: FsymDg_0846Help
Entry
FsymDg_0846       CDS       T01530                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
fsy  Frankia symbiont
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FsymDg_0846
  Amino acid metabolism
   00300 Lysine biosynthesis
    FsymDg_0846
Enzymes [BR:fsy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     FsymDg_0846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
992556..993689
Genome map
AA seq 377 aa AA seqDB search
MRLDLSLSATELTRAVVDIPSPSGAESTLADAVEEALTGLGGLRVDRDGDAVVARTELGR
QTRVLLAGHLDTVPIADNLPSRLADGHLYGCGTSDMKAGVAVMLRLAAVLAGSVGSVGTA
ASTPSVGFVPAHDVTWVFYDNEEVDAVRNGLRRLAANHRDWLDADLALLLEPTSGEIEAG
CQGTLRVAVTVPGRRAHSARSWLGENAIHRAAPLLERLASYQPRTVTIDGCVYREGLNAV
RITGGVAGNIVPDVCEVLVNYRFAPDRDVAQALDHVRETLDGFPVELTDSAAGALPGLTA
PAAAAFVRAVGRTPVAKYGWTDVARFAALGVPALNYGPGDPNLAHTRDEHVELELIDTAE
DVLRRYLTGPAAGPGRP
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttgatctgagcctgtcggcgacggagctgacccgcgctgtcgtcgacatcccc
tcgccgagcggggccgagagtacgctcgcggacgcggtcgaggaggccctgaccggcctc
ggcgggctgcgggtggaccgtgacggcgacgcggtcgtggcccggaccgagctgggccgg
cagacccgggtgctgctcgccgggcatctggacaccgttccgatcgcggacaacctgccc
agccggctggcggacgggcacctgtacggatgcggcacctcggacatgaaagccggggtg
gccgtgatgctgcggctggcggccgtcctcgcgggctccgtggggtctgtcggtaccgcc
gcgtccacgccgtccgtgggtttcgttcccgcgcacgacgtgacctgggtcttctacgac
aacgaagaggtcgacgccgtccgcaacggcctgcgccgcctggccgcgaaccatcgggac
tggctggacgccgaccttgcgctgctcctggagccgacgtcgggcgagatcgaggccggc
tgccagggcaccctgcgggtggccgtcacggtgccgggacgccgggcgcactcggcccgg
tcatggctcggggagaacgcgatccaccgggccgcgccgctgctggaacggctcgccagc
tatcagccgcggacggtgacgatcgacggctgtgtctaccgggagggtctcaacgccgtg
cggatcaccggcggcgtggccggcaacatcgttccggacgtgtgcgaggttctggtcaac
tacaggttcgctccggaccgtgacgttgcccaggcgctcgaccacgtccgggagaccctg
gacgggttcccggtggagctgaccgacagcgcggccggtgcgctgcccgggctgaccgcg
ccggccgcggccgcgttcgtccgggcggtggggcgcacgcccgtcgccaagtacggctgg
acggacgtggcccggttcgcggccctcggcgtcccggcgctcaactatggcccgggcgat
cccaatctggctcacacccgggacgaacacgtcgaactggagctgatcgacaccgctgag
gacgtgctacgccgctacctgaccgggccggccgccggtcccggccggccgtga

DBGET integrated database retrieval system