KEGG   Frankia symbiont: FsymDg_0880Help
Entry
FsymDg_0880       CDS       T01530                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
fsy  Frankia symbiont
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:fsy00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1032210..1033328
Genome map
AA seq 372 aa AA seqDB search
MFSFLRKVCQEPLGGIRQGTPAWRHLAAVATIAVAAAGVLTAGYRSGGVGTLRAPVSPVS
PVAADSPDATGIPGGEAAGNPLAGVRFYDDPDSQADAAATRLRGGDPANAGLLDKITNTP
QALWLGDWFPTAQVRATVAARVGSARAAQAIAVFAVYHIPARDCGGYSAGGAGSPDEYRA
WISEVAAGIGTGPAVVILEPDAIAGADCLPAADQQTRYTLIREAGTLLTQHGATVYLDAG
QPDWRNATEMAGRLRLAGVTAVRGFALNTANFVATTDLLAYGNRIVAELGGSGHFVVDTS
RNGYGPAPDKQWCNPPGRALGARPTTQTGDEHADAFLWVKGPGESDGTCNGGPPAGRFWP
AYALDLARRAPY
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgttctcgtttcttcgcaaggtctgccaggagccgctcggtgggatccgtcaggggacg
cccgcctggcggcacctggccgcggtggcgacgatcgccgtggctgcggccggtgtcctg
acggccggctaccggtccgggggcgtggggacgctgcgggcaccggtgtccccggtgtcc
ccggtcgccgcggacagcccagacgccacgggcatcccgggcggcgaggcggccggcaac
ccgctggccggcgtccgcttctacgatgatccagacagccaggcggacgccgccgcgacc
cgactgcgcggcggcgaccccgcgaacgcgggcctgctcgacaagatcacgaataccccg
caggcgctgtggctcggcgactggttccccaccgcgcaggtccgcgccacggtcgccgcg
cgggtcggcagcgcgcgggccgcccaggcgatcgcggtgttcgccgtctaccatataccg
gctcgcgactgcggcggctactccgccggcggggcgggctcgccggacgagtaccgcgcg
tggatctcggaggttgccgccggcatcggcacgggccccgccgtggtgatactcgagccg
gacgcgatcgccggcgcggactgcctccccgccgccgaccagcagacgcgctacacgctc
atccgtgaggcgggcacgctgctgacccagcacggggccaccgtctacctcgacgcgggg
cagccggactggcgcaacgccaccgagatggcgggacgcctacggcttgccggcgtcacc
gccgtgcgcggcttcgccctgaacacggcgaacttcgtcgccaccaccgacctgctggcc
tacggcaaccggatcgtcgccgagctcggcggcagcggccacttcgtcgtcgacaccagc
cgcaacggctacggcccggccccggacaagcagtggtgcaatccgccgggccgggcgctg
ggagcccgtccgaccacacagaccggtgacgagcacgcggacgcgttcctgtgggtgaag
ggccccggcgagtccgacggcacctgcaacggcggcccgccggccggcaggttctggccg
gcctacgccctcgacctggcccgccgagcgccctattag

DBGET integrated database retrieval system