KEGG   Frankia symbiont: FsymDg_0880Help
Entry
FsymDg_0880       CDS       T01530                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
fsy  Frankia symbiont
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FsymDg_0880
Enzymes [BR:fsy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     FsymDg_0880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1032210..1033328
Genome map
AA seq 372 aa AA seqDB search
MFSFLRKVCQEPLGGIRQGTPAWRHLAAVATIAVAAAGVLTAGYRSGGVGTLRAPVSPVS
PVAADSPDATGIPGGEAAGNPLAGVRFYDDPDSQADAAATRLRGGDPANAGLLDKITNTP
QALWLGDWFPTAQVRATVAARVGSARAAQAIAVFAVYHIPARDCGGYSAGGAGSPDEYRA
WISEVAAGIGTGPAVVILEPDAIAGADCLPAADQQTRYTLIREAGTLLTQHGATVYLDAG
QPDWRNATEMAGRLRLAGVTAVRGFALNTANFVATTDLLAYGNRIVAELGGSGHFVVDTS
RNGYGPAPDKQWCNPPGRALGARPTTQTGDEHADAFLWVKGPGESDGTCNGGPPAGRFWP
AYALDLARRAPY
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgttctcgtttcttcgcaaggtctgccaggagccgctcggtgggatccgtcaggggacg
cccgcctggcggcacctggccgcggtggcgacgatcgccgtggctgcggccggtgtcctg
acggccggctaccggtccgggggcgtggggacgctgcgggcaccggtgtccccggtgtcc
ccggtcgccgcggacagcccagacgccacgggcatcccgggcggcgaggcggccggcaac
ccgctggccggcgtccgcttctacgatgatccagacagccaggcggacgccgccgcgacc
cgactgcgcggcggcgaccccgcgaacgcgggcctgctcgacaagatcacgaataccccg
caggcgctgtggctcggcgactggttccccaccgcgcaggtccgcgccacggtcgccgcg
cgggtcggcagcgcgcgggccgcccaggcgatcgcggtgttcgccgtctaccatataccg
gctcgcgactgcggcggctactccgccggcggggcgggctcgccggacgagtaccgcgcg
tggatctcggaggttgccgccggcatcggcacgggccccgccgtggtgatactcgagccg
gacgcgatcgccggcgcggactgcctccccgccgccgaccagcagacgcgctacacgctc
atccgtgaggcgggcacgctgctgacccagcacggggccaccgtctacctcgacgcgggg
cagccggactggcgcaacgccaccgagatggcgggacgcctacggcttgccggcgtcacc
gccgtgcgcggcttcgccctgaacacggcgaacttcgtcgccaccaccgacctgctggcc
tacggcaaccggatcgtcgccgagctcggcggcagcggccacttcgtcgtcgacaccagc
cgcaacggctacggcccggccccggacaagcagtggtgcaatccgccgggccgggcgctg
ggagcccgtccgaccacacagaccggtgacgagcacgcggacgcgttcctgtgggtgaag
ggccccggcgagtccgacggcacctgcaacggcggcccgccggccggcaggttctggccg
gcctacgccctcgacctggcccgccgagcgccctattag

DBGET integrated database retrieval system