KEGG   Frankia symbiont: FsymDg_0996Help
Entry
FsymDg_0996       CDS       T01530                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
fsy  Frankia symbiont
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:fsy01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:fsy00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:fsy00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:fsy00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1165589..1166026)
Genome map
AA seq 145 aa AA seqDB search
MATTIDGAAAPAIEAPRSPQRRPVRTKARTNFELYAWLFMRVSGILLVFLVLGHLFIMNI
LDGGVQRIGFGFVAGRWASPFWRTWDLLMLVLAELHGTNGLRTVINDYAERPQTRFWLKM
LLYVSAFLVISLGSLVIFTFDPNIS
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaacgatcgacggcgcggccgccccggccatcgaggctccgcgcagcccacaa
cgccggcccgtacgcaccaaggcacggacgaacttcgagctctacgcgtggctgttcatg
cgggtctccggcatcctgctggtcttcctggtgctcggccacctgttcatcatgaacatt
cttgacggcggtgtgcagcggatcggcttcggtttcgtcgcgggccgctgggcctcgccg
ttctggcggacctgggacctgctcatgctcgtcctggccgaactgcacgggaccaacggc
ctgcgcaccgtcatcaacgactatgccgagcggccacagacccggttctggctgaagatg
ttgctgtacgtgtcggcgttcctggtgatctccctgggatcactggtcatcttcacgttc
gacccgaacatctcctga

DBGET integrated database retrieval system